1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Biotinylated Proteins
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. TGF-beta Receptor TGF-beta Receptor 2
  5. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)

TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78801
Handling Instructions Technical Support

The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
25 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), forms a non-promiscuous receptor complex with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, serving as the dedicated receptor for the TGF-beta cytokines TGFB1, TGFB2, and TGFB3. This receptor complex translates signals from the cell surface to the cytoplasm, orchestrating a wide range of physiological and pathological processes, such as cell cycle arrest, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Upon binding of the cytokine dimer, composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically, TGFBR2 constitutively activates TGFBR1 through phosphorylation. The activated TGFBR1, in turn, phosphorylates SMAD2, leading to its dissociation from the receptor and subsequent interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways. Overall, TGFBR2 exhibits transforming growth factor beta-activated receptor activity, playing a pivotal role in diverse cellular responses.

Biological Activity

1.This product does not contain protein kinase domain.
2.Immobilized Human Latent TGFB1 His at 1 μg/mL (100 μL/well) can bind Biotinylated Mouse TGF-beta RII His-Avi with a linear range of 1-31 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

Q62312-1 (I24-D184)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
TGFBR2; TGFR2; TbetaR-II; TGFβR2
AA Sequence

IPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD

Predicted Molecular Mass
21.7 kDa
분자량

Approximately 32-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78801
수량:
MCE Japan Authorized Agent: