TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)
The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), forms a non-promiscuous receptor complex with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, serving as the dedicated receptor for the TGF-beta cytokines TGFB1, TGFB2, and TGFB3. This receptor complex translates signals from the cell surface to the cytoplasm, orchestrating a wide range of physiological and pathological processes, such as cell cycle arrest, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Upon binding of the cytokine dimer, composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically, TGFBR2 constitutively activates TGFBR1 through phosphorylation. The activated TGFBR1, in turn, phosphorylates SMAD2, leading to its dissociation from the receptor and subsequent interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways. Overall, TGFBR2 exhibits transforming growth factor beta-activated receptor activity, playing a pivotal role in diverse cellular responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q62312-1 (I24-D184)
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kin
-
AA Sequence
IPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD
-
Predicted Molecular Mass
21.7 kDa
-
Molecular Weight
Approximately 32-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)