TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi)

The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TGFBR2/TGF-beta RII protein is a transmembrane kinase that forms a receptor complex with TGFBR1 and is specialized for TGFB1, TGFB2, and TGFB3 signal transduction. Binding of cytokine dimers activates TGFBR1 through TGFBR2 phosphorylation, initiating canonical SMAD-dependent TGF-β signaling. TGFBR2/TGF-beta RII Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), forms a non-promiscuous receptor complex with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, serving as the dedicated receptor for the TGF-beta cytokines TGFB1, TGFB2, and TGFB3. This receptor complex translates signals from the cell surface to the cytoplasm, orchestrating a wide range of physiological and pathological processes, such as cell cycle arrest, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Upon binding of the cytokine dimer, composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically, TGFBR2 constitutively activates TGFBR1 through phosphorylation. The activated TGFBR1, in turn, phosphorylates SMAD2, leading to its dissociation from the receptor and subsequent interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways. Overall, TGFBR2 exhibits transforming growth factor beta-activated receptor activity, playing a pivotal role in diverse cellular responses.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Conjugation

    Biotin

  • Synonyms

    TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kin

  • AA Sequence

    IPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD

  • Predicted Molecular Mass

    21.7 kDa

  • Molecular Weight

    Approximately 32-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00