TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with N-8*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with N-8*His labeled tag.
Background
TIM-3/HAVCR2 protein, a cell surface receptor, plays a pivotal role in modulating both innate and adaptive immune responses. Predominantly considered as having an inhibitory function, the reported stimulating functions suggest a nuanced influence based on cellular context and ligand specificity. It regulates macrophage activation and inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses, promoting immunological tolerance. In CD8+ cells, TIM-3 attenuates TCR-induced signaling by blocking NF-kappaB and NFAT promoter activities, leading to reduced IL-2 secretion. This inhibitory function is proposed to involve its association with LCK, impairing the phosphorylation of TCR subunits. Conversely, TIM-3 has been shown to activate TCR-induced signaling in T-cells, likely implicating ZAP70, LCP2, LCK, and FYN. The receptor for LGALS9, TIM-3's binding to LGALS9 is believed to suppress T-cell responses, leading to apoptosis of antigen-specific cells. Additionally, TIM-3 may recognize phosphatidylserine on apoptotic cells, mediating their phagocytosis, and positively regulates innate immune responses, particularly in dendritic cells. It also plays a role in suppressing nucleic acid-mediated innate immune responses in tumor-infiltrating dendritic cells and negatively regulates NK cell function in LPS-induced endotoxic shock. Interactions with various signaling molecules, including HMGB1, BAG6, PIK3R1, PIK3R2, FYN, and ILF3, further contribute to the intricate regulatory functions of TIM-3 in immune responses.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-8*His
-
Accession
G7P6Q7 (S22-R201)
-
Gene ID10214172
-
Molecular Construction
-
N-term
-
8*His
-
TIM-3 (S22-R201)
Accession # G7P6Q7 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HAVCR2; FLJ14428; Hepatitis A Virus Cellular Receptor 2; HAVcr-2; TIMD3; TIMD-3; TIM3; T-Cell Immunoglobulin And Mucin Domain 3; Tim-3; T Cell Immunoglobulin Mucin 3; CD366; Kidney Injury Molecule-3; T-Cell Immunoglobulin And Mucin Domain-Containing Prote
-
AA Sequence
SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR
-
Predicted Molecular Mass
20.8 kDa
-
Molecular Weight
Approximately 26-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)