TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with N-8*His labeled tag.

TIM-3/HAVCR2 protein, a cell surface receptor, plays a pivotal role in modulating both innate and adaptive immune responses. Predominantly considered as having an inhibitory function, the reported stimulating functions suggest a nuanced influence based on cellular context and ligand specificity. It regulates macrophage activation and inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses, promoting immunological tolerance. In CD8+ cells, TIM-3 attenuates TCR-induced signaling by blocking NF-kappaB and NFAT promoter activities, leading to reduced IL-2 secretion. This inhibitory function is proposed to involve its association with LCK, impairing the phosphorylation of TCR subunits. Conversely, TIM-3 has been shown to activate TCR-induced signaling in T-cells, likely implicating ZAP70, LCP2, LCK, and FYN. The receptor for LGALS9, TIM-3's binding to LGALS9 is believed to suppress T-cell responses, leading to apoptosis of antigen-specific cells. Additionally, TIM-3 may recognize phosphatidylserine on apoptotic cells, mediating their phagocytosis, and positively regulates innate immune responses, particularly in dendritic cells. It also plays a role in suppressing nucleic acid-mediated innate immune responses in tumor-infiltrating dendritic cells and negatively regulates NK cell function in LPS-induced endotoxic shock. Interactions with various signaling molecules, including HMGB1, BAG6, PIK3R1, PIK3R2, FYN, and ILF3, further contribute to the intricate regulatory functions of TIM-3 in immune responses.

Cynomolgus

HEK293

N-8*His

G7P6Q7 (S22-R201)

10214172

Partial

SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR

26-30 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/snu-387-cell.html