TNFRSF12A Protein, Human
Based on 1 Customer Validation
TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human is the recombinant human-derived TNFRSF12A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human is the recombinant human-derived TNFRSF12A protein, expressed by E. coli , with tag free.
TNFRSF12A Protein serves as the receptor for TNFSF12/TWEAK and, in certain cell types, acts as a weak inducer of apoptosis. Moreover, it plays a role in promoting angiogenesis and endothelial cell proliferation, and it may modulate cellular adhesion to matrix proteins. The protein associates with TRAF1 and TRAF2, and potentially with TRAF3, indicating its involvement in various cellular signaling pathways.
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF12A Protein, Human at 2 μg/mL (100 μL/well) can bind TWEAK/TNFSF12 Protein, Human (HY-P701045). The ED50 for this effect is 0.08974 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NP84-1 (E28-P80)
-
Molecular Construction
-
N-term
-
TNFRSF12A (E28-P80)
Accession # Q9NP84-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF12A; Tumor Necrosis Factor Receptor Superfamily Member 12A; TNF Receptor Superfamily Member 12A; FGF-Inducible 14; TweakR; Tweak-Receptor; FN14; Tumor Necrosis Factor Receptor Superfamily, Member 12A; CD266; Type I Transmembrane Protein Fn14; Fibrob
-
AA Sequence
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
-
Predicted Molecular Mass
5.6 kDa
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
