TRAC Protein, Human (HEK293, His)

The TRAC protein is part of the T-cell receptor and is critical for immune responses. TRAC, Human (HEK293, His) is the recombinant human-derived TRAC protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TRAC protein is part of the T-cell receptor and is critical for immune responses. TRAC, Human (HEK293, His) is the recombinant human-derived TRAC protein, expressed by HEK293, with C-His labeled tag.

Background

The constant region of the T cell receptor (TR) alpha chain, represented by the TRAC protein, is a fundamental component of alpha-beta T cell receptors crucial for the immune response. These antigen-specific receptors are present on the surface of T lymphocytes and play a pivotal role in recognizing peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APC), essential for effective T cell adaptive immunity against pathogens. Binding of the alpha-beta TR to the pMH complex initiates TR-CD3 clustering on the cell surface, activating intracellular LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E, and CD247, facilitating the recruitment of ZAP70. ZAP70, in turn, phosphorylates LAT, assembling the LAT signalosome, which branches signals to the calcium, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-kB) pathways. This leads to the mobilization of transcription factors critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire, generated in the thymus through V-(D)-J rearrangement, undergoes intrathymic selection to form a self-major histocompatibility (MH) restricted, non-autoaggressive peripheral T cell pool. Post-thymic interactions with pMH complexes shape the structural and functional avidity of the alpha-beta TR, a heterodimer composed of an alpha and beta chain linked by disulfide bonds. The assembly of alpha-beta TR heterodimers with CD3 coreceptor proteins occurs in the endoplasmic reticulum, forming the TR-CD3 (TcR or TCR). This assembly involves the association of TR alpha and TR beta chains with CD3D-CD3E and CD3G-CD3E heterodimers, respectively, and the final association with the CD247 homodimer, a critical step for transport to the cell surface.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TRAC (I1-S115)
      Accession # P01848
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TRAC; T Cell Receptor Alpha Chain Constant; T Cell Receptor Alpha Constant; IMD7; TCRA; TRCA

  • AA Sequence

    IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS

  • Predicted Molecular Mass

    14.8 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00