TRAC Protein, Human (HEK293, His)

Measured by its binding ability in a functional ELISA. Immobilized Human TRAC, His Tag at 5 μg/mL (100 μL/well) can bind TRAC Antibody with the EC₅₀ of 1.278 ng/mL.

Human

HEK293

C-His

P01848 (I1-S115)

28755

Partial

IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.