TRAC Protein, Human (HEK293, His)
The TRAC protein is part of the T-cell receptor and is critical for immune responses. TRAC, Human (HEK293, His) is the recombinant human-derived TRAC protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TRAC protein is part of the T-cell receptor and is critical for immune responses. TRAC, Human (HEK293, His) is the recombinant human-derived TRAC protein, expressed by HEK293, with C-His labeled tag.
Background
The constant region of the T cell receptor (TR) alpha chain, represented by the TRAC protein, is a fundamental component of alpha-beta T cell receptors crucial for the immune response. These antigen-specific receptors are present on the surface of T lymphocytes and play a pivotal role in recognizing peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APC), essential for effective T cell adaptive immunity against pathogens. Binding of the alpha-beta TR to the pMH complex initiates TR-CD3 clustering on the cell surface, activating intracellular LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E, and CD247, facilitating the recruitment of ZAP70. ZAP70, in turn, phosphorylates LAT, assembling the LAT signalosome, which branches signals to the calcium, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-kB) pathways. This leads to the mobilization of transcription factors critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire, generated in the thymus through V-(D)-J rearrangement, undergoes intrathymic selection to form a self-major histocompatibility (MH) restricted, non-autoaggressive peripheral T cell pool. Post-thymic interactions with pMH complexes shape the structural and functional avidity of the alpha-beta TR, a heterodimer composed of an alpha and beta chain linked by disulfide bonds. The assembly of alpha-beta TR heterodimers with CD3 coreceptor proteins occurs in the endoplasmic reticulum, forming the TR-CD3 (TcR or TCR). This assembly involves the association of TR alpha and TR beta chains with CD3D-CD3E and CD3G-CD3E heterodimers, respectively, and the final association with the CD247 homodimer, a critical step for transport to the cell surface.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P01848 (I1-S115)
-
Gene ID28755
-
Molecular Construction
-
N-term
-
TRAC (I1-S115)
Accession # P01848 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TRAC; T Cell Receptor Alpha Chain Constant; T Cell Receptor Alpha Constant; IMD7; TCRA; TRCA
-
AA Sequence
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS
-
Predicted Molecular Mass
14.8 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)