UPP1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

UPP1 belongs to the family of pentosyltransferases. UPP1 is expressed in the cytosol of most tissues and is important for the homeostatic regulation of intracellular and plasma uridine concentrations. UPP1 elevates its expression levels in many tumors. UPP1 Protein, Human (His) is a recombinant human UPP1 protein expressed by E. coli, with an N-6*His tag, consisting of 173 amino acids (M1-A173).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

UPP1 belongs to the family of pentosyltransferases. UPP1 is expressed in the cytosol of most tissues and is important for the homeostatic regulation of intracellular and plasma uridine concentrations. UPP1 elevates its expression levels in many tumors. UPP1 Protein, Human (His) is a recombinant human UPP1 protein expressed by E. coli, with an N-6*His tag, consisting of 173 amino acids (M1-A173).

Background

Uridinephosphorylase 1 (UPP1) is a member of the family of pentosyltransferase. UPP1 plays an important role in the pyrimidine salvage pathway through its catalysis of the reversible phosphorolysis of uridine to uracil. UPP1 is important for the homeostatic regulation of intracellular and plasma uridine concentratios. UPP1 is expressed in a variety of tissues including liver kidney and colon reflecting its diverse physiological roles. UPP 1 has been linked to cancer and metabolic disorders. The expression levels and the enzymatic activity of UPP1 are higher in human solid tumors than in adjacent normal tissues. The high level of UPP1 expression makes it a potential prognosticfactor for some cancers, such as oral squamous cell carcinoma[1].

In Vitro

UPP1 Protein, Human (His) can directly binds with recombinant AKT in vitro, as showed in the GST pull-down analysis[1].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • UPP1 (M1-A173)
      Accession # Q86Y75
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UPP1; Uridine Phosphorylase 1; UP; UDRPASE; UPASE; UPP; UrdPase 1; UPase 1; Uridine Phosphorylase

  • AA Sequence

    MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00