YTHDF2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,

Background

YTHDF2 is a protein that specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, regulating their stability and participating in various biological processes. m6A is an internal modification in mRNAs and some non-coding RNAs that influences mRNA stability and processing. YTHDF2 promotes degradation of m6A-containing mRNAs by interacting with either the CCR4-NOT complex or the ribonuclease P/MRP complex, depending on context. The YTHDF paralogs (YTHDF1, YTHDF2, and YTHDF3) share m6A-containing mRNA targets and redundantly mediate mRNA degradation and cellular differentiation. For mRNAs containing the RIDA/HRSP12 binding site (5'-GGUUC-3'), YTHDF2 cooperatively binds with RIDA/HRSP12 to recruit the ribonuclease P/MRP complex for endoribonucleolytic cleavage, while other m6A-containing mRNAs undergo deadenylation via YTHDF2-CNOT1 interaction and CCR4-NOT recruitment. During oocyte maturation, YTHDF2 regulates maternal transcript dosage by binding m6A-containing mRNAs (by similar). In spermatogenesis, it promotes degradation of m6A-containing transcripts encoding matrix metallopeptidases to regulate spermatogonial adhesion (by similar). Additionally, YTHDF2 is involved in hematopoietic stem cell specification, neural development, circadian regulation of hepatic lipid metabolism, inhibition of type I interferon response, cap-independent translation during heat shock, mitotic entry regulation, and formation of phase-separated membraneless compartments. It may also recognize m5C-modified RNAs and regulate rRNA processing. During viral infection, YTHDF2 binds m6A-modified viral RNAs to promote gene expression and replication of SV40 and KSHV.

Verified Bioactivity

Immobilized Human YTHDF2 at 5 μg/mL (100 μL/Well) on the plate can bind Anti-YTHDF2 antibody. The ED50 for this effect is 0.03-0.06279 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DF2; CLL-associated antigen KW-14; High-glucose-regulated protein 8; Renal carcinoma antigen NY-REN-2

  • AA Sequence

    SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

  • Predicted Molecular Mass

    63.02 kDa

  • Molecular Weight

    Approximately 65-74 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for YTHDF2 Protein, Human (His)
      ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00