YTHDF2 Protein, Human (His)
Based on 1 Customer Validation
YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,
YTHDF2 is a protein that specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, regulating their stability and participating in various biological processes. m6A is an internal modification in mRNAs and some non-coding RNAs that influences mRNA stability and processing. YTHDF2 promotes degradation of m6A-containing mRNAs by interacting with either the CCR4-NOT complex or the ribonuclease P/MRP complex, depending on context. The YTHDF paralogs (YTHDF1, YTHDF2, and YTHDF3) share m6A-containing mRNA targets and redundantly mediate mRNA degradation and cellular differentiation. For mRNAs containing the RIDA/HRSP12 binding site (5'-GGUUC-3'), YTHDF2 cooperatively binds with RIDA/HRSP12 to recruit the ribonuclease P/MRP complex for endoribonucleolytic cleavage, while other m6A-containing mRNAs undergo deadenylation via YTHDF2-CNOT1 interaction and CCR4-NOT recruitment. During oocyte maturation, YTHDF2 regulates maternal transcript dosage by binding m6A-containing mRNAs (by similar). In spermatogenesis, it promotes degradation of m6A-containing transcripts encoding matrix metallopeptidases to regulate spermatogonial adhesion (by similar). Additionally, YTHDF2 is involved in hematopoietic stem cell specification, neural development, circadian regulation of hepatic lipid metabolism, inhibition of type I interferon response, cap-independent translation during heat shock, mitotic entry regulation, and formation of phase-separated membraneless compartments. It may also recognize m5C-modified RNAs and regulate rRNA processing. During viral infection, YTHDF2 binds m6A-modified viral RNAs to promote gene expression and replication of SV40 and KSHV.
Immobilized Human YTHDF2 at 5 μg/mL (100 μL/Well) on the plate can bind Anti-YTHDF2 antibody. The ED50 for this effect is 0.03-0.06279 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9Y5A9 (S2-K579)
-
Gene ID51441
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DF2; CLL-associated antigen KW-14; High-glucose-regulated protein 8; Renal carcinoma antigen NY-REN-2
-
AA Sequence
SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
-
Predicted Molecular Mass
63.02 kDa
-
Molecular Weight
Approximately 65-74 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
-
≥ 90%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)