2. Search Result
Search Result
Results for "

sequence

" in MedChemExpress (MCE) Product Catalog:

656

Inhibitors & Agonists

6

Screening Libraries

15

Fluorescent Dye

29

Biochemical Assay Reagents

325

Peptides

2

MCE Kits

26

Inhibitory Antibodies

9

Natural
Products

28

Recombinant Proteins

3

Isotope-Labeled Compounds

26

Antibodies

6

Click Chemistry

277

Oligonucleotides

1

GMP Molecules

Cat. No. Product Name Target Research Area
  • HY-P1103
    CTCE-9908
    1 Publications Verification

    		 CXCR Cancer
    CTCE-9908 is a potent and selective CXCR4 antagonist. CTCE-9908 induces mitotic catastrophe, cytotoxicity and inhibits migration in CXCR4-expressing ovarian cancer cells .
  • HY-P11328
    GFOGER peptide

    		Integrin Others
    GFOGER peptide is an artificially synthesized collagen-mimetic sequence. GFOGER peptide acts as a ligand for α2β1, α11β1 and α1β1 integrins, thereby supporting integrin-mediated cell adhesion to collagen. GFOGER peptide triggers signaling pathways mediated by the α2β1 integrin receptor and upregulates osteoblast differentiation. GFOGER peptide accelerates and enhances bone formation at sites of refractory femoral defects. GFOGER peptide can be passively adsorbed onto polymer scaffolds for cell-free/growth factor-free bone formation. GFOGER peptide is used in biomaterials such as hydrogels and 3D bioinks for tissue engineering research including bone formation .
  • HY-P3732
    RGD-4C

    		Integrin Cancer
    RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
  • HY-P5353
    PA22-2

    IKVAV sequence; Laminin A-chain fragment

    		 Peptides Others
    PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)
  • HY-P11212
    Ac-RHKK(Ac)-AMC

    		Fluorescent Dye Metabolic Disease Cancer
    Ac-RHKK(Ac)-AMC (Compound S1) is a fluorescent substrate for SITR6, that is based on p53 sequence. Ac-RHKK(Ac)-AMC mimics H3K56 deacetylation site and significantly increases the deacetylation signal with low signal-to-background ratio. Ac-RHKK(Ac)-AMC can be used for ageing and cancers research .
  • HY-P3051
    CKS-17

    		Reverse Transcriptase Inflammation/Immunology
    CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
  • HY-P5217
    CSTSMLKAC (disulfide)

    		Peptides Others
    CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
  • HY-P10719
    Pepinh-MYD

    		MyD88 Infection Inflammation/Immunology
    Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. It holds potential for studying the role of MyD88 in viral infections .
  • HY-P0315
    Crosstide
    2 Publications Verification

    		 Akt Others
    Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
  • HY-P11094
    Tet1-Cys peptide

    		TET Protein Neurological Disease
    Tet1-Cys peptide is a peptide with the sequence HLNILSTLWKYRC. Tet1 (HLNILSTLWKYR) (HY-P10998) can specifically bind to the neuronal ganglioside receptor GT1b, possessing neuronal targeting capabilities. The Tet1-Cys peptide sequence has an added Cys, which can be used for drug conjugation for research on drug delivery .
  • HY-P2193
    TAT-amide

    		Peptides Infection
    TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-106262B
    Delcasertib hydrochloride
    3 Publications Verification

    KAI-9803 hydrochloride; BMS-875944 hydrochloride

    		 PKC Cardiovascular Disease Inflammation/Immunology
    Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
  • HY-P1603
    ACTH (22-39)

    Adrenocorticotropic Hormone (22-39)

    		 Melanocortin Receptor Metabolic Disease
    ACTH (22-39) is an adrenocorticotropic hormone (ACTH) fragment. ACTH (22-39) is the 22-39 sequence of ACTH.
  • HY-106262
    Delcasertib

    KAI-9803; BMS-875944

    		 PKC Cardiovascular Disease Inflammation/Immunology
    Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
  • HY-P3215
    Oxytocin parallel dimer

    		Oxytocin Receptor Endocrinology
    Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
  • HY-P1310
    VKGILS-NH2
    1 Publications Verification

    		 Protease Activated Receptor (PAR) Inflammation/Immunology
    VKGILS-NH2 is a reversed amino acid sequence control peptide for SLIGKV-NH2 (protease-activated receptor 2 (PAR2) agonist). VKGILS-NH2 has no effect on DNA synthesis in cells .
  • HY-P3221
    [Leu3]-Oxytocin

    		Oxytocin Receptor Endocrinology
    [Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu) .
  • HY-136727
    Ac-LEVD-CHO
    1 Publications Verification

    		 Caspase Cancer
    Ac-LEVD-CHO is a caspase-4 inhibitor. Ac-LEVD-CHO is a peptide with the sequence of Ac-Leu-Glu-Val-Asp-al .
  • HY-P3460A
    TDSRCVIGLYHPPLQVY TFA
    1 Publications Verification

    		 Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY TFA is a disordered control peptide. TDSRCVIGLYHPPLQVY TFA is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P1286
    PKC β pseudosubstrate

    		PKC Neurological Disease
    PKC β pseudosubstrate is a selective cell-permeable inhibitor of PKC .
  • HY-P3818
    PKCδ Peptide Substrate

    		PKC Others
    PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
  • HY-P5394
    Dby HY Peptide (608-622), mouse

    		Peptides Others
    Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
  • HY-P0329
    X-press Tag Peptide

    		Peptides Others
    X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.
  • HY-P10158
    PMAP-36

    Porcine cathelicidin PMAP-36

    		 Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
  • HY-P10719A
    Pepinh-MYD TFA

    		MyD88 Infection Inflammation/Immunology
    Pepinh-MYD TFA is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD TFA interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. Pepinh-MYD TFA holds potential for studying the role of MyD88 in viral infections .
  • HY-P4130
    MPS-Gαi2

    		Peptides Cancer
    MPS-Gαi2 is a peptide (membrane-permeable sequence). MPS-Gαi2 can be used for the research of cell adhesion .
  • HY-P1849A
    JAG-1, scrambled TFA
    1 Publications Verification

    scJag-1 TFA

    		 Notch Cardiovascular Disease
    JAG-1, scrambled (scJag-1) TFA is a scrambled sequence of JAG-1 (Jagged-1 protein). JAG-1, scrambled TFA has a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled TFA is usually used as a negative control .
  • HY-P11213
    Ac-RYQK(Ac)-AMC

    		Fluorescent Dye Metabolic Disease Cancer
    Ac-RYQK(Ac)-AMC (Compound S5) is a fluorescent substrate for SITR6, that is based on the H3 sequence. Ac-RYQK(Ac)-AMC mimics H3K56 deacetylation site and significantly increases the deacetylation signal with superior signal-to-background ratio. Ac-RYQK(Ac)-AMC can be used for ageing and cancers research .
  • HY-P3534
    EILDV (human, bovine, rat)

    		Peptides Cancer
    EILDV (human, bovine, rat) is an analogue of the active pentapeptide. EILDV (human, bovine, rat) has active tripeptide amino acid sequence LDV that is conserved in human, bovine, rat. EILDV (human, bovine, rat) can be used for the research of cell adhesion .
  • HY-P10638A
    TAT-CN21 (scrambled)

    		CaMK Cardiovascular Disease Neurological Disease
    TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exerts no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638) .
  • HY-P3526
    YQEAFRRFFGPV

    		Biochemical Assay Reagents Others
    YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability
  • HY-P1517
    β-Amyloid (31-35)

    		Amyloid-β Neurological Disease
    β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.
  • HY-P3893
    PSTAIR

    		CDK Metabolic Disease
    PSTAIR is a monoclonal antibody that recognizes the PSTAIR sequence in Cdc28, PSTAIR can be used as loading control .
  • HY-P4054
    IEIK 13

    		Peptides Others
    IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering
  • HY-P2162
    Kemptamide

    		Myosin Cancer
    Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .
  • HY-P4132
    Membrane-Permeable Sequence, MPS

    		Peptides Cancer
    Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .
  • HY-P1103A
    CTCE-9908 TFA

    		CXCR Cancer
    CTCE-9908 TFA is a potent and selective CXCR4 antagonist. CTCE-9908 TFA induces mitotic catastrophe, cytotoxicity and inhibits migration in CXCR4-expressing ovarian cancer cells .
  • HY-P4525
    Ala-Ala-Ala-Ala

    		Peptides Others
    Ala-Ala-Ala-Ala is a poly-L-alanine (PLA) sequences. PLA is a kind of key element of the crystalline domains of spider dragline and wild silkworm silks .
  • HY-P1138
    Scrambled 10Panx

    FSVYWAQADR

    		 Gap Junction Protein Others
    Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
  • HY-P10593
    Influenza A NP (383-391) (HLA-B27)

    		Transmembrane Glycoprotein Influenza Virus Cancer
    Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
  • HY-P5300A
    YNPCVMYL (Thioester: Cys4-Leu8) TFA

    		Peptides Others
    YNPCVMYL (Thioester: Cys4-Leu8) TFA is a polypeptide chain of the YNPCVMYL sequence. The link between the fourth and eighth amino acids in the sequence has the properties of a thioester, which is formed between cysteine (Cys4) and leucine (Leu8).
  • HY-P1311
    RLLFT-NH2

    		Drug Isomer Others
    RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
  • HY-P10190
    CADY

    		Peptides Others
    CADY is a cell-penetrating peptide (CPPs) peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .
  • HY-P3812
    Woodtide

    		DYRK Neurological Disease
    Woodtide is a substrate for the DYRK (DYRK) family of kinases whose sequence is based on that around the DYRK phosphorylation site in FKHR .
  • HY-P3523
    KGDS

    		Integrin Others
    KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser .
  • HY-P1870
    OVA sequence (323-336)

    		Peptides Inflammation/Immunology
    OVA sequence (323-336) is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogenicity.
  • HY-P11550
    VPGVG

    		Biochemical Assay Reagents Others
    VPGVG is a repeating sequence that constitutes elastin-like peptides. VPGVG is derived from sequences found in the hydrophobic regions of vertebrate elastin. Elastin-like peptides are temperature-responsive biomaterials .
  • HY-P5343
    p53 CBS

    p53 Consensus binding sequence

    		 MDM-2/p53 Others
    p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)
  • HY-P3287
    UL75 (14-42)，Human herpesvirus 5

    		Peptides Others
    UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .
  • HY-P3978
    ACTH (4-9)

    		Melanocortin Receptor Neurological Disease
    ACTH (4-9) is an adrenocorticotropic hormone (ACTH) fragment. ACTH (4-9) is the 4-9 sequence fragment of ACTH .

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: