PNC-27
Based on 1 Customer Validation
PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research.
For research use only. We do not sell to patients.
- Purity: 99.73%
- CAS No.: 1159861-00-3
- Formula: C188H293N53O44S
- Molecular Weight:4031.73
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
PNC-27 (50 μg/mL; 0-3 h) induces cancer cell death[1].
PNC-27 (50 μg/mL; 15 min) binds to cell membrane-bound HDM-2 in A2058 and MCF-7 cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:MIA-PaCa-2 cells
-
Concentration:50 μg/mL
-
Incubation Time:0-3 hours
-
Result:Induced 100% cell death in 90 min.
-
Cell Line:A2058 and MCF-7 cells
-
Concentration:50 μg/mL
-
Incubation Time:15 min
-
Result:Showed colocalization of PNC-27 with HDM-2 in the cancer cell membrane.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:MllPTD/WT/Flt3ITD/ITD AML mice[2]
-
Dosage:40 mg/kg
-
Administration:Intraperitoneal injection; 40 mg/kg; once daily; 2 or 3 weeks
-
Result:Reduced AML engraftment and prolonged survival.
Chemical Information
-
CAS No. 1159861-00-3
-
Appearance Solid
-
Molecular Weight 4031.73
-
Formula C188H293N53O44S
-
Color White to off-white
-
Sequence Shortening
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : ≥ 100 mg/mL (24.80 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (271 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sarafraz-Yazdi E, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010 Feb 2;107(5):1918-23. [Content Brief]
[2]. Wang H, et al. Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia. Leukemia. 2020 Jan;34(1):75-86. [Content Brief]
[3]. Ehsan Sarafraz-Yazdi, et al. PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis. Biomedicines. 2022 Apr 20;10(5):945. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2480 mL | 1.2402 mL | 2.4803 mL | 6.2008 mL |
| 5 mM | 0.0496 mL | 0.2480 mL | 0.4961 mL | 1.2402 mL | |
| 10 mM | 0.0248 mL | 0.1240 mL | 0.2480 mL | 0.6201 mL | |
| 15 mM | 0.0165 mL | 0.0827 mL | 0.1654 mL | 0.4134 mL | |
| 20 mM | 0.0124 mL | 0.0620 mL | 0.1240 mL | 0.3100 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.