country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P1866A

Copy Link Print Information

β-Endorphin, equine TFA

Name: β-Endorphin, equine TFA
Brand: MedChemExpress
SKU: HY-P1866A
Price: 90.00 USD
Availability: InStock
Rating: 5 (2 reviews)

2 Cited Publications

Avis client

Based on 2 publication(s) in Google Scholar

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Pureté : 97.02%
Formule: C₁₅₄H₂₄₈N₄₂O₄₄S.xC₂HF₃O₂
Masse moléculaire:3423.94 (free acid)

Stockage:

Sealed storage, away from moisture.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

β-Endorphin, equine TFA Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique
- Description
- IC₅₀ & Target
- In Vitro
- In Vivo
Chemical Information
Publications (2)
Solvant et solubilité
- In Vitro
Pureté et documentation
Références
Help & FAQs
Classifications
Bioz

Activité biologique

Description

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties^[1]^[2]^[3]^[4].

IC₅₀ & Target

δ Opioid Receptor/DOR

μ Opioid Receptor/MOR

Voir tous les produits spécifiques à Isoform Opioid Receptor :

In Vitro

β-Endorphin, equine TFA (0, 0.6, 1.2 and 3 μM) inhibits the striatal dopamine release^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

β-Endorphin, equine TFA (2 or 20 μg/kg; i.p., once) effects the acquisition and retention in the rat^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:

Adult Female Wistar rats^[3]
Dosage:

2 or 20 μg/kg
Administration:

2 or 20 μg/kg; i.p., once
Result:

Hindered the acquisition of shuttle avoidance learning and habituation of a rearing response to a tone at a dose of 20 μg/kg. Caused amnesia in the avoidance task with the pre- or post-training administration of 2 μg/kg and pre-training administration of 20 μg/kg.

Chemical Information

Appearance Solid
Masse moléculaire 3423.94 (free acid)
Formule C₁₅₄H₂₄₈N₄₂O₄₄S.xC₂HF₃O₂
Color White to off-white
Sequence

Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln
Sequence Shortening

YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Structure Classification
- Others
Initial Source
- Endogenous metabolite
Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Publications (2)

All

Sort by:

Journal Impact Factor

Brain Behav Immun

2026 Aug 18:138:106964. PMID: 42612847
Domest Anim Endocrinol

Pilot study of β-endorphin concentrations in horses with pituitary pars intermedia dysfunction using a newly validated enzyme-linked immunosorbent assay. [Abstract]

2025 Nov 26:95:106982. PMID: 41317409

Solvant et solubilité

In Vitro:

H₂O : 100 mg/mL (Need ultrasonic)

View the Complete Stock Solution Preparation Table

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage Dosage
mg/kg
Animal Weight (Per Animal) Animal Weight (Per Animal)
g
Dosing Volume (Per Animal) Dosing Volume (Per Animal)
μL
Number of Animals Number of Animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Working solution concentration: 0.22 mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact

MedChemExpress (MCE) .

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (271 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Yahav Dikshtein, et al. β-Endorphin via the Delta Opioid Receptor is a Major Factor in the Incubation of Cocaine Craving. Neuropsychopharmacology. 2013 Nov; 38(12): 2508-2514.

[2]. Niinistö KE, et al. Plasma levels of heat shock protein 72 (HSP72) and beta-endorphin as indicators of stress, pain and prognosis in horses with colic. Vet J. 2010 Apr;184(1):100-4. [Content Brief]

[3]. Izquierdo I. Effects of a low and a high dose of beta-endorphin on acquisition and retention in the rat. Behav Neural Biol. 1980 Dec;30(4):460-4. [Content Brief]

[4]. Loh HH, et al. beta-Endorphin in vitro inhibition of striatal dopamine release. Nature. 1976 Dec 9;264(5586):567-8. [Content Brief]

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

β-Endorphin, equine TFA

2 Cited Publications

100 mg Obtenir un devis

Subscribe to the

MedChemExpress

Newsletter

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis

Amount: USD 0.00

Activité biologique
- Description
- IC₅₀ & Target
- In Vitro
- In Vivo
Chemical Information
Publications (2)
Solvant et solubilité
- In Vitro
Pureté et documentation
Références

Nom du produit:
Cat. No.:
Quantité:
MCE Japan Authorized Agent:

Nom du produit:
CAS No.:
Species:
Pureté:
Quantité:

β-Endorphin, equine TFA

Publications Citing Use of MedChemExpress (MCE) β-Endorphin, equine TFA

Voir tous les produits spécifiques à Isoform Opioid Receptor