PINT-87aa
PINT-87aa, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa suppresses glioblastoma cell proliferation in vitro and in vivo.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C396H628N140O115S13
- Masse moléculaire:9607.03
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Voir tous les produits spécifiques à Isoform DNA/RNA Synthesis
More
Activité biologique
Both 456 and 4121 cells overexpressing PINT-87aa exhibits G1 arrest and reduces cell proliferation without obvious cellular toxicity, whereas PINT-87aa K.O. SW1783 and Hs683 cells shows increased cell cycle and cell proliferation rates[1].
The mRNA of PAF1 downstream genes (CPEB1, SOX-2, c-Myc, etc.) is inhibited transcriptionally in PIN87aa-overexpressing 456 and 4121 cells compared with that in control cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
PINT-87aa K.O. cells results in significantly increased xenograft tumor volumes of nude mice[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Masse moléculaire 9607.03
-
Formule C396H628N140O115S13
-
Sequence
Met-Leu-Trp-Leu-Pro-Asp-Arg-Gly-Ser-Cys-Ser-Ala-Arg-Ser-Pro-Ser-Gly-Met-Leu-Arg-Gly-Ala-Pro-Gly-Gly-Trp-Arg-Tyr-Gly-Arg-Arg-Cys-Gly-Arg-Arg-Arg-Gln-Ser-Cys-Cys-Cys-Cys-Cys-Cys-Cys-Ser-His-Val-Gly-Ala-Pro-Leu-Ser-Phe-His-Arg-Glu-Ala-Ser-Leu-Val-Ser-His-Asp-Gly-His-Asp-Ile-Met-Lys-Gln-His-Cys-Gly-Glu-Glu-Ser-Ile-Arg-Gly-Ala-His-Gly-Tyr-Lys-Asn-Lys
-
Sequence Shortening
MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvant et solubilité
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)