country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-103303

Copy Link Print Information

CRSP-1

CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast.

For research use only. We do not sell to patients.

CAS No.: 697327-12-1
Formula: C₁₇₅H₂₉₄N₅₄O₄₉S₅
Molecular Weight:4098.86

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

CRSP-1 Chemical Structure

CAS No.: 697327-12-1

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast^[1].

Chemical Information

CAS No. 697327-12-1
Molecular Weight 4098.86
Formula C₁₇₅H₂₉₄N₅₄O₄₉S₅
Sequence

Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly-NH2 (Disulfide bridge: Cys2-Cys7)
Sequence Shortening

SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG-NH2 (Disulfide bridge: Cys2-Cys7)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Notoya M, et al., A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. Eur J Pharmacol. 2007 Apr 10;560(2-3):234-9. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock