Cys-β-Amyloid (1-42), human
Cys-β-Amyloid (1-42), human is a Cys-labeled β-Amyloid (1-42), human TFA (HY-P1363). β-Amyloid (1-42), human TFA is a peptide composed of 42 amino acids that plays a key role in the pathogenesis of Alzheimer's disease.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C206H316N56O61S2
- Molecular Weight:4617.18
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
In Vitro
β-Amyloid Aggregation Guidelines (Following is our recommended protocol.
This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide is dissolved in cold hexafluoro-2-propanol (HFIP). The peptide is incubated at room temperature for at least 1 h to establish monomerization and randomization of structure.
2. The HFIP is removed by evaporation, and the resulting peptide is stored as a film at -20 or -80 °C.
3. The resulting film is dissolved in anhydrous DMSO at 5 mM and then dilutes into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution is age 48 h at 4-8 °C. The sample is then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers are in the supernatant. The supernatant is diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
Molecular Weight 4617.18
-
Formel C206H316N56O61S2
-
SMILES
O=C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CC(O)=O)C(N[C@@H](CO)C(NCC(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@@H](CCC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CC4=CNC=N4)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CC6=CC=CC=C6)C(N[C@@H](CC7=CC=CC=C7)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCCN)C(NCC(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@@H](C)CC)C(NCC(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N[C@@H](C(C)C)C(NCC(NCC(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CS)N
-
Sequence
Cys-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
-
Sequence Shortening
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Amyloid: Congo Red Amyloid Staining
Congo red amyloid staining is a histochemical method used to detect extracellular amyloid deposits in tissue sections based on the affinity of Congo red dye for β-pleated sheet-rich protein aggregates. When bound to amyloid, Congo red produces characteristic apple-green birefringence under polarized light microscopy, which is widely regarded as a diagnostic feature of amyloid deposition in histopathology. The diagnostic principle relies on the combination of dye binding (congophilia) and optical anisotropy under polarized illumination, which distinguishes amyloid from most non-amyloid eosinophilic extracellular deposits in routine histological evaluation. Amyloid identification by Congo red staining remains a cornerstone in diagnostic pathology despite the availability of adjunct methods such as immunohistochemistry and mass spectrometry, particularly because of its ability to localize deposits directly within tissue architecture. The specificity of Congo red-positive deposits is incre
-
Alzheimer’s Disease Modeling
Alzheimer’s Disease (AD) is a neurodegenerative disorder characterized by a progressive decline in cognitive functions and loss of specific types of neurons and synapses. Alzheimer's symptoms can be simulated in mice by injecting drugs (such as Aβ) or genetically modified.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)