EGF Protein, Human

103 Cited Publications
Customer Review

Based on 103 publication(s) in Google Scholar

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Background

EGF Protein emerges as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro environments, along with fostering the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesiotropic hormone, driving magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Notably, EGF Protein possesses the capability to induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Its molecular interactions include binding to EGFR, thereby promoting EGFR dimerization, and interacting with RHBDF2, suggesting involvement in diverse cellular processes. Furthermore, EGF Protein engages with RHBDF1, potentially influencing the retention of EGF in the endoplasmic reticulum and regulating its degradation through endoplasmic reticulum-associated degradation (ERAD).

In Vitro

EGF Protein, Human (0-500 ng/mL, 72 h) promotes the proliferation of NIH 3T3 cells[3].

In Vivo

EGF Protein (Human) (10 μg/g, cream, a single dose for 7 days) reduces inflammatory infiltrate and results in wound re-epithelialization in rats with full thicknessskin wounds[1].
EGF Protein (Human) (50 μg/g, cream, every 24 h for 7 days) significantly stimulates re-epithelialization at high levels, preferably in combination with a protease inhibitor in pigs with thickness wounds on the back[1].
EGF Protein (Human) (30 μg/kg, s.c., daily for 3 weeks) attenuates the oesophageal damage normally caused by the sclerotherapy (surgical dilation of the oesophagus) procedure in Gottingen minipigs[1].

Verified Bioactivity

Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is <200 pg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EGF (N971-R1023)
      Accession # P01133
    • C-term
  • Protein Length

    Full Length of EGF

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

  • Predicted Molecular Mass

    6.2 kDa

  • Molecular Weight

    Approximately 6-11 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM PB, 200 mM NaCl, pH 7.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
6.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00