1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Mouse

EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
5 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

    EGF Protein, Mouse purchased from MCE. Usage Cited in: Environ Int. 2025 Jan:195:109266.

    Lung organoid cultured in lung organoid medium with 50 ng/mL EGF, 10 ng/mL FGF10, 500 ng/mL RSPO1, 100 ng/mL Noggin, 100 nM SB202190 and 10 μM Y-27632.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

    Background

    Epidermal growth factor (EGF) binds to epidermal growth factor receptor and stimulates an intracellular signal transduction cascade, leading to activation of genes that regulate cell proliferation, angiogenesis, motility, and metastasis[1]. Epidermal growth factor (EGF) is initially synthesized as a large precursor of 1217 amino acids that is glycosylated and can be secreted by cells. Epidermal growth factor (EGF) mRNA and protein are expressed in a number of adult tissues, especially in epithelial cells in the gastrointestinal tract. Predominant sites of synthesis of this peptide are the submandibular glands, the Brunner glands in the small intestine and the kidney[2].

    Actividad biológica

    1. The ED50 is <0.1 ng/mL as measured by BALB/c 3T3 cells, corresponding to a specific activity of >1.0 × 107 units/mg.
    2. Mouse EGFR protein immobilized on CM5 Chip can bind Mouse EGF with an affinity constant of 15.2nM as determined in SPR assay.

    • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 60.44 pg/mL, corresponding to a specific activity is 1.65×107 units/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P01132 (N977-R1029)

    Gene ID
    Molecular Construction
    N-term
    EGF (N977-R1029)
    Accession # P01132
    C-term
    Protein Length

    Full Length of EGF

    Synonyms
    rMuEGF; Pro-epidermal growth factor; Urogastrone
    AA Sequence

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

    Predicted Molecular Mass
    6 kDa
    Peso molecular

    Approximately 6 kDa, based on SDS-PAGE under reducing conditions.

    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias

    EGF Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    EGF Protein, Mouse

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    EGF Protein, Mouse
    Cat. No.:
    HY-P7067
    Cantidad:
    MCE Japan Authorized Agent: