Copy Link Print Information

BMP-7 Protein, Human

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process. BMP-7 also eliminates vascular inflammation, maintains vascular integrity, reduces vascular calcification, and stimulates in situ phosphate ossification deposition. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • BMP-7 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4]. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells.

Background

Bone Morphogenetic Protein 7 (BMP-7) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells, associated with a variety of human tumors[1].
BMP-7 also appears to exhibit anti-inflammatory effects on the vasculature, and may function to maintain vascular integrity[3].
BMP-7 attenuates vascular calcification, but also corrects hyperphosphatemia associated with uremia, and stimulates orthotopic skeletal phosphate deposition while simultaneously preventing vascular calcification by direct action on vascular smooth muscle cells[4].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[5].
BMP-7 inhibits primary human aortic smooth muscle cells (SMCs) proliferation due to stimulation with serum, platelet-derived growth factor subunit BB (PDGF-BB) or TGFβ1, and maintains the expression of the vascular SMC phenotype[3].
And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[2].
However, BMP-7 knockdown results the expression of p-Smad1/5/9 significantly decreased, accompanied with BMP-7-Smad1/5/9 signaling pathway inactive and epithelial-mesenchymal transition (EMT) process reverse[1].
In lung cancer, BMP-7 inhibits bone metastasis, and induces apoptosis and cell cycle arrest. In malignant melanoma, BMP-7 can induce mesenchymal-epithelial transformation and inhibit the metastasis of cancer cells. BMP-7 inhibit epithelial-mesenchymal transition (EMT)-related genes and cell invasion, inhibit telomerase, shorten telomeres, and induce the aging and apoptosis of breast cancer cells. BMP-7 has also been found to increase the cell proliferation and migration potential in a model of metastatic breast cancer in the bone and prostate cancer[1].
BMP-7 is widely found in different animals, while the sequence in mouse is highly similar to rat (100.00%), and human (97.67%).

In Vitro

BMP-7 (300 ng/mL) initiates a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[6].
BMP-7 (50 ng/mL; 1, 3, 5, 7, and 17 d) induces SCG neurons dendritic growth[7].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P18075 (S293-H431)

  • Gene ID
    655  [NCBI]
  • Molecular Construction
    • N-term
    • BMP-7 (S293-H431)
      Accession # P18075
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BMP7; Eptotermin Alfa; Bone Morphogenetic Protein 7; BMP-7; Osteogenic Protein 1; OP1; OP-1

  • AA Sequence

    STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

  • Predicted Molecular Mass

    15.7 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 30% acetonitrile, 0.1% TFA.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10mM HAc. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Sun R, et al. Expression of BMP-7 in cervical cancer and inhibition of epithelial‑mesenchymal transition by BMP-7 knockdown in HeLa cells. Int J Mol Med. 2020 May;45(5):1417-1424. [Content Brief]

[2]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095. [Content Brief]

[3]. Dorai H, et al. Bone morphogenetic protein-7 (osteogenic protein-1) inhibits smooth muscle cell proliferation and stimulates the expression of markers that are characteristic of SMC phenotype in vitro. J Cell Physiol. 2000 Jul;184(1):37-45. [Content Brief]

[4]. Mathew S, et al. Function and effect of bone morphogenetic protein-7 in kidney bone and the bone-vascular links in chronic kidney disease. Eur J Clin Invest. 2006 Aug;36 Suppl 2:43-50. [Content Brief]

[5]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542. [Content Brief]

[6]. Xu RH, et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol. 2002 Dec;20(12):1261-4. [Content Brief]

[7]. Beck HN, et al. Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons. BMC Neurosci. 2001;2:12. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    BMP-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2021 Oct 1;12:628671. [Abstract]

    Customer Validation
     BMP-7 Protein, Human (100 ng/mL; +TGF-β1 (10 ng/ml); 10% FBS) significantly increased the expression levels of E-cadherin and ZO-1 in HPMC.

  • 1/16

    BMP-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2021 Oct 1;12:628671. [Abstract]

    Customer Validation
     BMP-7 Protein, Human (100 ng/mL; +TGF-β1 (10 ng/ml); 10% FBS) significantly increased the expression levels of E-cadherin in HPMC.

  • 1/16

    BMP-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2021 Oct 1;12:628671. [Abstract]

    Customer Validation
     BMP-7 Protein, Human (100 ng/mL; +TGF-β1 (10 ng/ml); 10% FBS) significantly increased the expression levels of ZO-1 in HPMC.

  • 1/16

    BMP-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Front Med (Lausanne). 2021 Sep 23:8:746298. [Abstract]

    Customer Validation
     BMP-7 Protein, Human (25 ng/mL; 7 days in expansion medium; differentiation medium was changed every 2–3 days for 13–15 days of culture) induced human Liver organoid differentiation.

  • BMP-7 Protein, Human Product Image
    1/16
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • Experimental Validation Results for BMP-7 Protein, Human
  • BMP-7 Protein, Human Product Image