1. Peptides
  2. ELA RR>GG

ELA RR>GG (Synonyms: ELA-32 negative control)

Cat. No.: HY-P2250
Handling Instructions

ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ELA RR>GG Chemical Structure

ELA RR>GG Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196)[1].

Molecular Weight

3769.55

Formula

C₁₆₂H₂₇₁N₅₇O₃₉S₄

Sequence

Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Gly-Gly-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro (Disulfide bridge: Cys17-Cys22)

Sequence Shortening

QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

ELA RR>GGELA-32 negative controlOthersgrowthfactormutantnegative controlInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ELA RR>GG
Cat. No.:
HY-P2250
Quantity:
MCE Japan Authorized Agent: