Jingzhaotoxin-34
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons.
For research use only. We do not sell to patients.
- Formula: C154H219N39O45S7
- Molecular Weight:3561.08
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
Chemical Information
-
Molecular Weight 3561.08
-
Formula C154H219N39O45S7
-
Sequence
Gly-Cys-Gly-Thr-Met-Trp-Ser-Pro-Cys-Ser-Thr-Glu-Lys-Pro-Cys-Cys-Asp-Asn-Phe-Ser-Cys-Gln-Pro-Ala-Ile-Lys-Trp-Cys-Ile-Trp-Ser-Pro (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
-
Sequence Shortening
ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
-
Primary Dorsal Root Ganglion Sensory Neuron Culture
Primary dorsal root ganglion sensory neuron culture isolates DRG neuronal somata from rodent or human ganglia, dissociates tissue enzymatically and mechanically, and maintains post-mitotic sensory neurons in vitro for readouts such as neurite outgrowth, immunocytochemical marker expression, calcium imaging, electrophysiology, RNA/protein analysis, or neuropeptide release assays. The method reflects peripheral sensory neuron biology because DRG neurons are primary sensory neurons whose cell bodies reside in dorsal root ganglia and whose cultured dissociated cells can retain neuronal morphology, sensory-neuron marker expression, and stimulus-responsive properties depending on the downstream assay.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Jingzhaotoxin-34 Related Classifications
HY-P5773 Related Classifications
Powered by Bioz