Copeptin (rat)
Based on 1 Customer Validation
Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity : 99.97%
- CAS No.: 86280-64-0
- 화학식: C183H307N57O61
- 분자량:4281.74
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- Protocol
- 순도&문서
- References
-
Help & FAQs
Biological Activity
제품 설명
Chemical Information
-
CAS No. 86280-64-0
-
Appearance Solid
-
분자량 4281.74
-
화학식 C183H307N57O61
-
Color White to off-white
-
Sequence
Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr
-
Sequence Shortening
AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
용액&용해도
In Vitro:
H2O : ≥ 100 mg/mL (23.35 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
순도&문서
-
Data Sheet (267 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2335 mL | 1.1677 mL | 2.3355 mL | 5.8387 mL |
| 5 mM | 0.0467 mL | 0.2335 mL | 0.4671 mL | 1.1677 mL | |
| 10 mM | 0.0234 mL | 0.1168 mL | 0.2335 mL | 0.5839 mL | |
| 15 mM | 0.0156 mL | 0.0778 mL | 0.1557 mL | 0.3892 mL | |
| 20 mM | 0.0117 mL | 0.0584 mL | 0.1168 mL | 0.2919 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Copeptin (rat) Related Classifications
HY-P5009 Related Classifications
Powered by Bioz