IP-10/CXCL10 Protein, Human

5 Cited Publications
고객리뷰

Based on 5 publication(s) in Google Scholar

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Human
  • Source: E. coli
  • 보관:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • References
  • Help & FAQs

Biological Activity

제품 설명

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

Background

CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
  CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

In Vitro

Recombinant human CXCL10 (5-10 μg/mL; 3 days) attenuates the proliferation of CAG, U266 and RPMI-8266 myeloma cells, and human umbilical vein endothelial cells, implying that CXCL10 exhibits anti-angiogenic capacity[2].
Recombinant human CXCL10 (500 ng//mL; for 2 h) induces up-regulation of CXCR3 expression in MDA-MB-231, MCF-7 and T47D cells[3].

Verified Bioactivity

1.The ED50 is <0.2 μg/mL as measured by HUVEC cells, corresponding to a specific activity of >5.0 × 103 units/mg.
2.Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Human CXCR3. The ED50 for this effect is <0.18 μg/mL.
4.Immobilized Recombinant Human CXCL10 at 2 μg/mL(100 μL/well) can bind Human CXCL10 Antibody(Eldelumab,Research Grade). The ED50 for this effect is 1.0-10.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL10 (M22-P98)
      Accession # P02778
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1

  • AA Sequence

    VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

  • Predicted Molecular Mass

    8.6 kDa

  • 분자량

    Approximately 9-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

견적 받기 해외재고보유

Other size
견적 받기
Please select quantity
Amount: USD 0.00