MmTx1 toxin (Synonyms: Micrurotoxin 1)

Cat. No.: HY-P5860: FAQs
Data Sheet Handling Instructions

Molarity Calculator

MmTx1 toxin (Micrurotoxin 1) is an allosteric GABA_A receptor modulator that increases GABA_A receptor susceptibility to agonist.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

MmTx1 toxin Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	MmTx1 toxin (Micrurotoxin 1) is an allosteric GABA_A receptor modulator that increases GABA_A receptor susceptibility to agonist^[1].
Molecular Weight	7205.00
Formula	C₂₉₅H₄₅₅N₉₅O₉₇S₁₀
Sequence	Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-Arg-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Sequence Shortening	LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Rosso JP, et al. MmTX1 and MmTX2 from coral snake venom potently modulate GABAA receptor activity. Proc Natl Acad Sci U S A. 2015 Feb 24;112(8):E891-900. [Content Brief]

MmTx1 toxin Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

MmTx1 toxinMicrurotoxin 1Micrurotoxin1Micrurotoxin-1GABA ReceptorGamma-aminobutyric acid Receptorγ-Aminobutyric acid Receptorcoral snake venomHEK 293hippocampal neuronXenopus oocytesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

MmTx1 toxin (Synonyms: Micrurotoxin 1)

MmTx1 toxin Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review