Myr5A peptide
Myr5A peptide is an acylated peptide composed of apolipoprotein A1 (ApoA1) analog peptide 5A peptide coupled to the saturated fatty acid myristate. Myr5A peptide self-assembled into lipid nanostructures can be used to encapsulate anthracycline Doxorubicin (HY-15142A) and Valrubicin (HY-13772) for compound release studies in vitro.
For research use only. We do not sell to patients.
- Formula: C211H321N47O57
- Molecular Weight:4428.09
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
Molecular Weight 4428.09
-
Formula C211H321N47O57
-
Sequence
{Myr}-Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-
-
Sequence Shortening
{Myr}-DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Myr5A peptide Related Classifications
HY-P10453 Related Classifications
Powered by Bioz