country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Art. -Nr.: HY-P5651

Copy Link Print Information

PhD4

PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Formel: C₁₅₆H₂₁₉N₄₃O₃₇S₆
Molecular Weight:3481.06

Speicherung:

Please store the product under the recommended conditions in the Certificate of Analysis.

PhD4 Chemical Structure

Größe

Preis

Verfügbarkeit

Menge

Amount: USD 0.00

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biologische Aktivität

Beschreibung

PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans^[1].

Chemical Information

Molecular Weight 3481.06
Formel C₁₅₆H₂₁₉N₄₃O₃₇S₆
Sequence

Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Phe-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Phe-Tyr-Leu-Gly-Arg-Val-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29)
Sequence Shortening

ACYCRIPACFAGERRYGTCFYLGRVWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29)
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Please store the product under the recommended conditions in the Certificate of Analysis.

Reinheit & Dokumentation

Select Batch:

Reinheit: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

Verweise

[1]. Tsvetkova EV, et al. alpha-Defensins from blood leukocytes of the monkey Papio hamadryas. Biochemistry (Mosc). 2006 Aug;71(8):879-83. [Content Brief]

Calculators

Molaritätsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Konzentration Konzentration

Volumen Volumen

Molecular Weight Molecular Weight

Verdünnungsrechner

Konzentration _{(Stammlösung)} × Volumen _{(Stammlösung)} = Konzentration _{(Ziellösung)} × Volumen _{(Ziellösung)}

Konzentration _{(Stammlösung)} Konzentration _{(Stammlösung)}

Volumen _{(Stammlösung)} Volumen _{(Stammlösung)}

Konzentration _{(Ziellösung)} Konzentration _{(Ziellösung)}

Volumen _{(Ziellösung)} Volumen _{(Ziellösung)}

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

Angebot einholen Auf Lager

Other size

Angebot einholen