1. Recombinant Proteins
  2. 4-1BBR/TNFRSF9 Protein, Human (HEK 293, His)

4-1BBR/TNFRSF9 Protein, Human (HEK 293, His)

Cat. No.: HY-P70678
Handling Instructions

4-1BBR/TNFRSF9 Protein, Human (HEK 293, His) is a recombinant Human 4-1BBR/TNFRSF9 Protein expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8+ T cells[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $70 In-stock
Estimated Time of Arrival: December 31
50 μg $210 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
Species

Human

Source

HEK 293

Accession

Q07011 (L24-Q186)

Gene ID

3604

Molecular Weight

28-35 kDa

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Recombinant Human 4-1BBRTNFRSF9 (CD137) is an inducible T cell molecule belonging to the TNF receptor superfamily. It has been shown that signaling through CD137 by either its natural ligand, 4-1BBL, or by agonistic Ab’s costimulates activation of CD4+ and CD8+ T cells in a CD28-independent fashion, leading to activation of the NF-κB, c-Jun NH2-terminal kinase/stress-activated protein kinase (JNK/SAPK), and p38 signaling pathways. In addition to its role in promoting the expansion of antigen-specific T cells, CD137 signaling may also prevent activation-induced death of CD8+ T cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BBR/TNFRSF9 Protein, Human (HEK 293, His)
Cat. No.:
HY-P70678
Quantity:
MCE Japan Authorized Agent: