1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-7
  6. ALK-7 Protein, Human (HEK293, Fc)

ALK-7 is a type I receptor serine-threonine kinase mediate inhibitory as well as stimulatory signals for growth and differentiation by binding to members of the TGF-β superfamily. ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells. ALK-7 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 113 amino acids (M1-E113).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
> 500 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

ALK-7 is a type I receptor serine-threonine kinase mediate inhibitory as well as stimulatory signals for growth and differentiation by binding to members of the TGF-β superfamily. ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells[1][2][3]. ALK-7 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 113 amino acids (M1-E113).

Background

ALK-7, also known as ACVR1C, is a serine/threonine kinase consistent with the characteristics of a type-I receptor. ALK-7 is predominantly expressed in central nervous system. ALK-7 can form complexes with type II receptor serine-threonine kinases for TGF-β and activin in a ligand-dependent manner[1].
The ALK-7 gene encodes a 55-kDa cell-surface protein that exhibits up to 78% amino acid sequence identity in the kinase domain to previously isolated type I receptors for TGF-β and activin. In the extracellular domain, however, ALK-7 is more divergent, displaying comparable similarities with all members of the ALK subfamily. Originally identified and cloned from rat brain, ALK-7 mRNA is present throughout the digestive and central nervous system of rats. The function of ALK-7 as a type I receptor was confirmed with a constitutively activemutant form that activated a TGF-β/activin response reporter. ALK-7 has also been found to activate some components of the Smad pathway, such as Smad2 and Smad3, in fetal and adult rat pancreas. In the rat pheochromocytoma PC12 cell line, ALK-7 not only activated both Smad2, Smad3, and the MAPK of extracellular signal-regulated kinase and JNK, but it inhibits cell proliferation as well. The human gene for ALK-7 has been mapped to the genetic location of 2q24.1-q3, with most of the mRNA located in the brain, pancreas, and colon. ALK-7 mediates high-ambient glucose-induced cardiomyoblasts apoptosis through the activation of Smad2/3[1][2][3].
ALK-7 combined with specific ligands, such as Nodal, activin B and growth differentiation factor (GDF), can activate Smads and other signaling pathways, thereby regulating cell proliferation, differentiation and apoptosis in various cells. Besides that, ALK-7, along with ALK-5 and ALK-6, participated in renal interstitial fibrosis[1][2][3].

In Vitro

Activin AB binds ActRIIA-Fc with a high affinity, whereas activin AB shows little binding to ALK7-Fc or ALK4-Fc (.5-5 μg). An estimated Kd of activin AB to ActRIIA-Fc is 333 pM. The affinity of activin AB for ActRIIA-Fc/ALK7-Fc is greater than that for ActRIIA-Fc and has an estimated Kd of 125 pM. This indicates the enhanced activin AB binding to the activin receptors in the presence of ALK7[5].

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human ALK-7 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human Nodal. The ED50 for this effect is 243.4 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human ALK-7 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human Nodal. The ED50 for this effect is 243.4 ng/mL.
Assay Procedure

Materials
Biotin
Pre-chilled sterile water
Wash buffer: 1X PBS-T (PBS with 0.05% Tween-20)
Blocking buffer: 1% BSA in 1X PBS-T
TMB substrate solution: Mix substrate solution A and B at a 1:1 ratio immediately before use
Stop solution: 2 M H2SO4
ALK-7 Protein, Human (HEK293, Fc) (HY-P74417)

Procedure
Biotinylation
1. Dissolution of Biotin Reagent: Remove Biotin from -10 to -30°C and immediately dissolve 1 tube of Biotin in 180 μL of cold purified water. Gently pipette to mix and obtain a 10 mM Biotin solution.
2. Calculation of EZ-LinkTM Sulfo-NHS-LC-LC-Biotin, No-WeighTM Format Volume: Calculate the volume to be added.
3. Incubation: Incubate at room temperature in the dark for 45 minutes.
4. Quantification of Biotinylated Protein: Use the BCA assay to quantify the protein concentration. The concentration of biotinylated Nodal is 900 μg/mL.

ELISA Detection
1. Coating: Dilute ALK-7 protein to 2 μg/mL in 1X PBS, add 100 μL/well, and incubate overnight at 4°C.
2. Washing: Wash the plate with wash buffer (260 μL/well) , once, and pat dry.
3. Blocking: Add 150 μL/well of blocking buffer (1% BSA in 1X PBS-T) , incubate at 25°C with shaking at 450 rpm for 4 hours.
4. Dilution of Biotinylated Nodal: Prepare dilutions at concentrations of 0, 0.1, 0.5, 1, 5, 10, 50, 100, 500, 1000, 5000, 10000, 500000 ng/mL.
5. Add Biotinylated Nodal Protein: Add 100 μL/well, incubate at 25°C with shaking at 450 rpm for 2 hours.
6. Washing: Wash the plate with Wash Buffer (260 μL/well) , five times, with each wash lasting 1 minute, then pat dry.
7. Add Secondary Antibody: Dilute the secondary antibody at a 1:2000 ratio, add 100 μL/well, incubate at 25°C with shaking at 450 rpm for 1 hour.
8. Washing: Wash the plate with wash buffer (260 μL/well) , three times, with each wash lasting 1 minute, then pat dry.
9. Add TMB Substrate Solution: Add 100 μL/well, incubate at room temperature in the dark for 15 minutes.
10. Stop reaction: Add 100 μL H2SO4 2 M/well.
11. Read plate: Measure absorbance at 450 nm.
12. Using GraphPad Prism software, plot a curve with the OD value as the vertical axis and the Biotinylated Human Nodal protein concentration as the horizontal axis, and calculate the ED50 value.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8NER5 (L22-E113)

Gene ID
Molecular Construction
N-term
ALK-7 (L22-E113)
Accession # Q8NER5
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Activin receptor type IC; ACTR-IC; ACVRLK7; ALK7
AA Sequence

LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

분자량

The recombinant human ALK-7 consists of 92 amino acids & hFc tag and predicts a molecular mass of 35.96 kDa. It migrates as an approximately 43-56 kDa band in SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ALK-7 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ALK-7 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74417
수량:
MCE Japan Authorized Agent: