CD3D-CD3E Heterodimer Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, His), has molecular weight of 16-30 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, His), has molecular weight of 16-30 kDa.
Background
CD3D Protein, an integral part of the TCR-CD3 complex on the surface of T-lymphocytes, plays a pivotal role in the adaptive immune response. Activated by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals through the CD3 chains CD3D, CD3E, CD3G, and CD3Z, which harbor immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these ITAMs are phosphorylated by Src family protein tyrosine kinases LCK and FYN, activating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable for thymocyte differentiation, contributing to the correct intracellular assembly and surface expression of the TCR-CD3 complex. Thymocytes lacking a functional TCR-CD3 complex face impaired differentiation. CD3D also interacts with coreceptors CD4 and CD8, establishing a functional link between the TCR and coreceptors crucial for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers that, in turn, interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be substituted by TCRgamma and TCRdelta. These intricate interactions highlight CD3D's multifaceted role in orchestrating T-cell responses.
Verified Bioactivity
1. Immobilized Human CD3D&CD3E Heterodimer-His at 1 μg/mL (100 μl/well) can bind Anti-Human/Monkey CD3E mAb . The ED50 of Anti-Human/Monkey CD3E mAb is ≤20.36 ng/mL.
2. Immobilized Human CD3E&CD3D, His Tag at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for OKT3, mFc Tag with the EC50 of ≤20 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Molecular Construction
-
N-term
-
CD3D (F22-A105)
Accession # P04234-1 -
6*His
-
C-term
-
N-term
-
CD3E (D23-D126)
Accession # P07766 -
C-term
-
-
Synonyms
Mafa-AG; MHC class I antigen; CD3E; T3E; CD3 Epsilon Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3; T-Cell Surface Glycoprotein CD3 Epsilon Chain; CD3e Molecule; CD3-Epsilon; CD3e Antigen; CD3epsilon; CD3E Prot
-
AA Sequence
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA&DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
-
Predicted Molecular Mass
17.9 kDa (CD3E) & 16.7 kDa (CD3D)
-
Molecular Weight
Approximately 32-42 kDa & 25-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)