Copy Link Print Information

Complement C3a Protein, Human

5 Cited Publications
Avis client

Based on 5 publication(s) in Google Scholar

Complement C3/C3a protein plays a key role in initiating the complement system through processing by C3 convertase in both the classical and alternative pathways. Complement C3/C3a protein is involved in various immune and inflammatory responses and also has a role in regulating blood pressure. Complement C3a Protein, Human is a recombinant Complement C3/C3a protein expressed in E. coli, no tag..

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
  • Species: Human
  • Source: E. coli
  • Stockage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Complement C3a Protein, Human Product Image
Size
Prix
Stock
Quantité
Amount: USD 0.00
Please select quantity
or
or

* Veuillez sélectionner la quantité avant d'ajouter des articles.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Trouvez votre distributeur local Your local distributor: Hycultec GmbHHycultec
  • Activité biologique
  • Technical Parameters
  • Product Properties
  • Documentation
  • Références
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Activité biologique

Description

Complement C3/C3a protein plays a key role in initiating the complement system through processing by C3 convertase in both the classical and alternative pathways. Complement C3/C3a protein is involved in various immune and inflammatory responses and also has a role in regulating blood pressure. Complement C3a Protein, Human is a recombinant Complement C3/C3a protein expressed in E. coli, no tag.[1][2][3][4][5][6][7][8][9][10][11].

Background

Complement C3 can be cleaved by C3 convertases or by blood proteases (such as thrombin) and immune cell-derived proteases (such as cathepsins) at sites of inflammation, producing two split products: Complement C3/C3a and Complement C3/C3b. Complement C3/C3a participates in various immune and inflammatory responses and exhibits bidirectional effects in different immune cells, potentially influencing immune responses and disease processes through different mechanisms[1][2].
(a) In monocytes and macrophages, Complement C3/C3a mediates through TLR-4, promoting the production of pro-inflammatory mediators such as IL-1β, TNF-α, IL-6, and PGE2. (b) In mast cells, Complement C3/C3a induces histamine degranulation. (c) In eosinophils, it stimulates calcium mobilization, oxidative burst, and degranulation. (d) Additionally, Complement C3/C3a reduces neutrophil migration into the bloodstream by inhibiting mobilization factors. (e) Complement C3/C3a also plays a crucial role in brain inflammation by activating brain endothelial cells and recruiting leukocytes. (f) Complement C3/C3a can directly or indirectly alter T cell responses through interaction with receptors C3aR on antigen-presenting cells (APCs) and T cells[3][4][5][6].
Complement C3/C3a is present in plasma-derived FVIII products and can promote T cell proliferation mediated by pdFVIII (FVIII products extracted from plasma) and lipopolysaccharides (HY-D1056) in dendritic cells (DCs)[7].
Additionally, Complement C3 is reported to have antioxidant stress activity, protecting human bronchial epithelial cells from cigarette smoke-induced oxidative stress and inhibiting apoptosis[7].

In Vitro

Complement C3/C3a (Human) (2 μg/mL) increases the expression of NF-κB and IL-1β in human podocytes[9].
Complement C3/C3a (Human) (200 ng/mL, 2 hours) upregulates the expression of VCAM-1 and ICAM-1 in mouse primary cerebral endothelial cells induced by Lipopolysaccharides (HY-D1056) through the activation of p38 MAPK and NF-κB phosphorylation, thereby exerting an anti-inflammatory effect[11].

In Vivo

Complement C3/C3a (Human) receptor antagonist (JR14a) (10 mg/kg, i.g., once daily for 7 days) can reduce proteinuria levels in the Heymann nephritis rat model induced by anti-Fx1A antibodies, indicating that C3a is a pro-inflammatory factor in this model[9].

Verified Bioactivity

Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.1-0.5 μg/mL.

Results
  • Experimental Validation Results for Complement C3a Protein, Human
    Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.1759 μg/mL, corresponding to a specific activity is 5685.0483 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01024 (S672-R748)

  • Gene ID
    718  [NCBI]
  • Molecular Construction
    • N-term
    • C3a (S672-R748)
      Accession # P01024
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rHuComplement C3/C3a; Complement Component C3a; C3a; Anaphylatoxin

  • AA Sequence

    SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

  • Masse moléculaire

    Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Pureté

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Complement C3a Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Références

[1]. Coulthard LG, et al. Is the complement activation product C3a a proinflammatory molecule? Re-evaluating the evidence and the myth. J Immunol. 2015 Apr 15;194(8):3542-8. [Content Brief]

[2]. Markiewski MM, et al. Complement and coagulation: strangers or partners in crime? Trends Immunol. 2007 Apr;28(4):184-92. [Content Brief]

[3]. Wu F, et al. Complement component C3a plays a critical role in endothelial activation and leukocyte recruitment into the brain. J Neuroinflammation. 2016 Jan 28;13:23. [Content Brief]

[4]. Kubota Y. 1992. The effect of human anaphylatoxins and neutrophils on histamine release from isolated human skin mast cells. J. Dermatol. 19: 19–26.

[5]. Asgari E., et al. 2013. C3a modulates IL-1β secretion in human monocytes by regulating ATP efflux and subsequent NLRP3 inflammasome activation. Blood 122: 3473–3481.

[6]. Daffern P. J., et al. 1995. C3a is a chemotaxin for human eosinophils but not for neutrophils. I. C3a stimulation of neutrophils is secondary to eosinophil activation. J. Exp. Med. 181: 2119–2127.

[7]. Ringler E, et al. Complement protein C3a enhances adaptive immune responses towards FVIII products. Haematologica. 2023 Jun 1;108(6):1579-1589. [Content Brief]

[8]. Pei Y, et al. Complement component 3 protects human bronchial epithelial cells from cigarette smoke-induced oxidative stress and prevents incessant apoptosis. Front Immunol. 2022 Dec 20;13:1035930. [Content Brief]

[9]. Gao S, et al. Complement C3a and C3a Receptor Activation Mediates Podocyte Injuries in the Mechanism of Primary Membranous Nephropathy. J Am Soc Nephrol. 2022 Sep;33(9):1742-1756. [Content Brief]

[10]. Lillegard KE, et al. Differential effects of complement activation products c3a and c5a on cardiovascular function in hypertensive pregnant rats. J Pharmacol Exp Ther. 2014 Nov;351(2):344-51. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculateur de dilution

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
100 mg

Obtenir un devis En stock

Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.1759 μg/mL, corresponding to a specific activity is 5685.0483 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.1759 μg/mL, corresponding to a specific activity is 5685.0483 U/mg.

  • 1/16

    Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Customer Validation
     Complement C3a Protein, Human (200 nM; 48 h) significantly decreased the viability of U251 cells.

  • 1/16

    Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Customer Validation
     Complement C3a Protein, Human (200 nM; 48 h) significantly decreased insulin receptor (IR) expression in U251 cells.

  • 1/16

    Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Customer Validation
     Complement C3a Protein, Human (200 nM; 48 h) significantly lowered the mRNA levels of mtATP6, mtCytB, and mtDN1R in U251 cells.

  • 1/16

    Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Customer Validation
     Complement C3a Protein, Human (200 nM; 48 h) caused irregular membrane structures in mitochondrial area of U251 cells compared with vehicle controls.

  • 1/16

    Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Customer Validation
     Complement C3a Protein, Human (200 nM; 48 h) significantly increased ROS generation in U251 cells.

  • Complement C3a Protein, Human Product Image
    1/16
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Experimental Validation Results for Complement C3a Protein, Human
  • Complement C3a Protein, Human Product Image

  • Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Complement C3a Protein, Human (200 nM; 48 h) significantly decreased the viability of U251 cells.

  • Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Complement C3a Protein, Human (200 nM; 48 h) significantly decreased insulin receptor (IR) expression in U251 cells.

  • Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Complement C3a Protein, Human (200 nM; 48 h) significantly lowered the mRNA levels of mtATP6, mtCytB, and mtDN1R in U251 cells.

  • Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Complement C3a Protein, Human (200 nM; 48 h) caused irregular membrane structures in mitochondrial area of U251 cells compared with vehicle controls.

  • Complement C3a Protein, Human purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Jun 20:e70145. [Abstract]

    Complement C3a Protein, Human (200 nM; 48 h) significantly increased ROS generation in U251 cells.