Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His)

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Ephrin-A5/EFNA5 protein, a cell surface GPI-bound ligand for Eph receptors, plays a pivotal role in neuronal, vascular, and epithelial development, where Eph receptors are critical for migration, repulsion, and adhesion. EFNA5 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. This protein induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor, a process requiring the activity of the Fyn tyrosine kinase. EFNA5 activates the EPHA3 receptor, regulating cell-cell adhesion and cytoskeletal organization, and, in conjunction with EPHA2, potentially contributes to shaping lens fiber cells and maintaining lens transparency. It may actively stimulate axon fasciculation and mediate communication between pancreatic islet cells, influencing glucose-stimulated insulin secretion. As a cognate ligand for EPHA7, EFNA5 regulates brain development by modulating cell-cell adhesion and repulsion. It binds to the receptor tyrosine kinases EPHA2, EPHA3, and EPHB1 and forms a ternary complex with EPHA3 and ADAM10, mediating EFNA5 extracellular domain shedding by ADAM10, which in turn regulates the internalization and function of the EFNA5-EPHA3 complex. EFNA5 also binds to EPHB2 and interacts with EPHA8, activating the latter receptor.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EFNA5 (Q21-Q206)
      Accession # O08543
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    EFNA5; LERK-7; Prev. EPLG7; Alternative Protein EFNA5; EPH-Related Receptor Tyrosine Kinase Ligand 7; GLC1M; LERK7; EFL5; Ephrin-A5; RAGS; AF1; Ephrin A5; AL-1

  • AA Sequence

    QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ

  • Predicted Molecular Mass

    22.5 kDa

  • Molecular Weight

    Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00