Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His)
Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The Ephrin-A5/EFNA5 protein, a cell surface GPI-bound ligand for Eph receptors, plays a pivotal role in neuronal, vascular, and epithelial development, where Eph receptors are critical for migration, repulsion, and adhesion. EFNA5 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. This protein induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor, a process requiring the activity of the Fyn tyrosine kinase. EFNA5 activates the EPHA3 receptor, regulating cell-cell adhesion and cytoskeletal organization, and, in conjunction with EPHA2, potentially contributes to shaping lens fiber cells and maintaining lens transparency. It may actively stimulate axon fasciculation and mediate communication between pancreatic islet cells, influencing glucose-stimulated insulin secretion. As a cognate ligand for EPHA7, EFNA5 regulates brain development by modulating cell-cell adhesion and repulsion. It binds to the receptor tyrosine kinases EPHA2, EPHA3, and EPHB1 and forms a ternary complex with EPHA3 and ADAM10, mediating EFNA5 extracellular domain shedding by ADAM10, which in turn regulates the internalization and function of the EFNA5-EPHA3 complex. EFNA5 also binds to EPHB2 and interacts with EPHA8, activating the latter receptor.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
O08543 (Q21-Q206)
-
Molecular Construction
-
N-term
-
EFNA5 (Q21-Q206)
Accession # O08543 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EFNA5; LERK-7; Prev. EPLG7; Alternative Protein EFNA5; EPH-Related Receptor Tyrosine Kinase Ligand 7; GLC1M; LERK7; EFL5; Ephrin-A5; RAGS; AF1; Ephrin A5; AL-1
-
AA Sequence
QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)