IL-12 beta Protein, Rat (HEK293, Fc)
IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a lg-like domain (43-90 a.a). IL-12 beta Protein, Rat (M1-S335) is produced in HEK293 cells with a C-Terminal hFc-tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a lg-like domain (43-90 a.a). IL-12 beta Protein, Rat (M1-S335) is produced in HEK293 cells with a C-Terminal hFc-tag.
Background
IL-12 beta Protein, as known as IL12 p40 subunit or IL-12B, heterodimerizes with the IL-12 p35 subunit (IL-12A) to form IL-12 and with the IL23 p19 subunit to form IL-23, exerting different regulating functions[1].
IL-12 and IL23 belong to IL-12 family, are involved in proinflammatory responses and expressed by activated macrophages that serve as an essential inducer of Th1 cells development[2].
IL-12 signals via IL-12Rβ1 and IL-12Rβ2 mediated by p-STAT4, whereas IL-23 signals via IL-12Rβ1 and IL-23R mediated by p-STAT1 and p-STAT3[3].
The sequence of amino acids in IL-12 beta alpha proteins of rat is very different from human (69.04%), but shows high similarity with mouse (92.24%).
Interleukin 12 (IL-12) family have been known to be inflammatory factors, induce autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis[4].
In Vitro
IL-12/rAAV2 (encoding IL-12 in rat) (1.96 × 112 particles/mL, 3 μL; i.c.v.; 5 μL/min) efficiently induces long lasting expression of IL-12 in rats, and results the greater infiltration of activated microglia cells in the tumor associated improved immune reactions, leading the inhibited growth of implanted glioblastoma and the increased survival time of rats[5].
In Vivo
IL-12 level is reduced in white adipose tissue (WAT, involved in chronic diseases such as obesity, type 2 diabetes, and atherosclerosis) compared with skeletal muscle (SM) in intense exercise training and weight loss rat[6].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
XP_006246209.1 (M23-S335)
-
Molecular Construction
-
N-term
-
IL-12β (M23-S335)
Accession # XP_006246209.1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL12B; Interleukin-12 Subunit Beta; Prev. NKSF2; Interleukin 12, P40; IL-12B; IL12, Subunit P40; CLMF2; IL-12 Subunit P40; NKSF; CLMF P40; CLMF; Cytotoxic Lymphocyte Maturation Factor 2, P40; Interleukin 12B (Natural Killer Cell Stimulatory Factor 2, Cyto
-
AA Sequence
MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS
-
Predicted Molecular Mass
62.5 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Lu X. Impact of IL-12 in Cancer. Curr Cancer Drug Targets. 2017;17(8):682-697. [Content Brief]
[2]. Gunsten S, et al. IL-12 p80-dependent macrophage recruitment primes the host for increased survival following a lethal respiratory viral infection. Immunology. 2009 Apr;126(4):500-13. [Content Brief]
[3]. Gotthardt D, Trifinopoulos J, Sexl V, Putz EM. JAK/STAT Cytokine Signaling at the Crossroad of NK Cell Development and Maturation. Front Immunol. 2019 Nov 12;10:2590. [Content Brief]
[4]. Tait Wojno ED, Hunter CA, Stumhofer JS. The Immunobiology of the Interleukin-12 Family: Room for Discovery. Immunity. 2019 Apr 16;50(4):851-870. [Content Brief]
[5]. Chiu TL, et al. The treatment of glioblastoma multiforme through activation of microglia and TRAIL induced by rAAV2-mediated IL-12 in a syngeneic rat model. J Biomed Sci. 2012 Apr 22;19(1):45. [Content Brief]
[6]. Gomez-Merino D, et al. Effects of chronic exercise on cytokine production in white adipose tissue and skeletal muscle of rats. Cytokine. 2007 Oct;40(1):23-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
