IL-15 Protein, Mouse (Biotinylated, HEK293, Fc-Avi)

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived IL-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of IL-15 Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is 114 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived IL-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of IL-15 Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is 114 a.a., with molecular weight of 50-60 kDa.

Background

The IL-15 protein is a cytokine that plays a crucial role in the development of both inflammatory and protective immune responses against microbial invaders and parasites. It achieves this by modulating immune cells from both the innate and adaptive immune systems. IL-15 stimulates the proliferation and activation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. In monocytes, IL-15 induces the production of chemokines IL8 and monocyte chemotactic protein 1/CCL2, which attract neutrophils and monocytes to sites of infection. Unlike most cytokines, IL-15 is expressed on the surface of IL-15-producing cells in association with its high affinity IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. This binding triggers phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 rapidly phosphorylates STAT6, consequently controlling mast cell survival and the release of cytokines like IL4.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-hFc
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Synonyms

    IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15

  • AA Sequence

    NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

  • Predicted Molecular Mass

    41.5 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00