IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F^[1][2][3][4]. IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant mouse IL-17A-17F heterodimer protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F belongs to the IL-17 cytokine family. IL-17A-17F heterodimer, IL-17A and IL-17F homodimers can be produced by differentiated Th17 cells^[1][2]. IL-17F shares the most similarities with IL-17A (50% homology)^[2]. Both IL-17A and IL-17F can induces antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13)^[2][3]. IL-17A, IL-17F and IL-17A-17F use the same receptor complex: IL-17RA and IL-17RC heterodimer. And they trigger qualitatively similar signaling pathways. IL-17A-17F shows intermediate biological activity between IL-17A (most potent) and IL-17F (least potent)^[2][4].

IL-17A/IL-17F (0.1-500 ng/mL; 0-24 h) significantly induces MCP-1 and MIP-2 production in a dose- and time- dependent manner in SV40 MES 13 cells^[5].

Immobilized Mouse IL-17R alpha, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Mouse IL-17A&F, His Tag with the EC₅₀ of 19.6 ng/mL determined by ELISA.

Mouse

HEK293

C-Avi;C-8*His

Q62386 (A26-A158)&Q7TNI7-1 (R29-A161)

16171  [NCBI]&257630  [NCBI]

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA&RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

22-25 kDa & 27-30 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14.  [Content Brief]

  [2]. Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46(1):7-11.  [Content Brief]

  [3]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.  [Content Brief]

  [4]. McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50(4):892-906.  [Content Brief]

  [5]. Iyoda M, et al. IL-17A and IL-17F stimulate chemokines via MAPK pathways (ERK1/2 and p38 but not JNK) in mouse cultured mesangial cells: synergy with TNF-alpha and IL-1beta. Am J Physiol Renal Physiol. 2010 Mar;298(3):F779-87.  [Content Brief]