IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F. IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant mouse IL-17A-17F heterodimer protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F[1][2][3][4]. IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant mouse IL-17A-17F heterodimer protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

Background

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F belongs to the IL-17 cytokine family. IL-17A-17F heterodimer, IL-17A and IL-17F homodimers can be produced by differentiated Th17 cells[1][2]. IL-17F shares the most similarities with IL-17A (50% homology)[2]. Both IL-17A and IL-17F can induces antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13)[2][3]. IL-17A, IL-17F and IL-17A-17F use the same receptor complex: IL-17RA and IL-17RC heterodimer. And they trigger qualitatively similar signaling pathways. IL-17A-17F shows intermediate biological activity between IL-17A (most potent) and IL-17F (least potent)[2][4].

In Vitro

IL-17A/IL-17F (0.1-500 ng/mL; 0-24 h) significantly induces MCP-1 and MIP-2 production in a dose- and time- dependent manner in SV40 MES 13 cells[5].

Verified Bioactivity

Immobilized Mouse IL-17R alpha, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Mouse IL-17A&F, His Tag with the EC50 of 19.6 ng/mL determined by ELISA.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA&RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

  • Molecular Weight

    Approximately 22-25 kDa & 27-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00