LOX-1/OLR1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

Background

LOX-1/OLR1 Protein functions as a receptor that plays a crucial role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL, a marker of atherosclerosis, induces endothelial cell activation and dysfunction, leading to pro-inflammatory responses, pro-oxidative conditions, and apoptosis. The association with oxLDL triggers the activation of NF-kappa-B, resulting in increased intracellular reactive oxygen species production and various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in lipid metabolism, LOX-1/OLR1 acts as a receptor for HSP70, facilitating antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Moreover, it is involved in inflammatory processes, acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1/OLR1 serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. It forms homodimers, potentially organizing into hexamers composed of three homodimers, and interacts with HSP70.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat LOX-1 at 5 μg/mL (100 μL/well) can bind AGE-BSA, The ED50 for this effect is 0.724 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rat LOX-1 at 5 μg/mL (100 μL/well) can bind AGE-BSA, The ED50 for this effect is 0.724 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • LOX-1 (L60-Q364)
      Accession # O70156
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    OLR1; CDNA, FLJ79252, Weakly Similar To Oxidized Low-Density Lipoprotein Receptor 1; Oxidized Low Density Lipoprotein Receptor 1; Oxidised Low Density Lipoprotein (Lectin-Like) Receptor 1; CLEC8A; Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1;

  • AA Sequence

    LQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ

  • Molecular Weight

    Approximately 43-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00