LOX-1/OLR1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.
Background
LOX-1/OLR1 Protein functions as a receptor that plays a crucial role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL, a marker of atherosclerosis, induces endothelial cell activation and dysfunction, leading to pro-inflammatory responses, pro-oxidative conditions, and apoptosis. The association with oxLDL triggers the activation of NF-kappa-B, resulting in increased intracellular reactive oxygen species production and various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in lipid metabolism, LOX-1/OLR1 acts as a receptor for HSP70, facilitating antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Moreover, it is involved in inflammatory processes, acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1/OLR1 serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. It forms homodimers, potentially organizing into hexamers composed of three homodimers, and interacts with HSP70.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Rat LOX-1 at 5 μg/mL (100 μL/well) can bind AGE-BSA, The ED50 for this effect is 0.724 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
O70156 (L60-Q364)
-
Molecular Construction
-
N-term
-
His
-
LOX-1 (L60-Q364)
Accession # O70156 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
OLR1; CDNA, FLJ79252, Weakly Similar To Oxidized Low-Density Lipoprotein Receptor 1; Oxidized Low Density Lipoprotein Receptor 1; Oxidised Low Density Lipoprotein (Lectin-Like) Receptor 1; CLEC8A; Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1;
-
AA Sequence
LQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ
-
Molecular Weight
Approximately 43-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)