MCP-2/CCL8 Protein, Mouse
Based on 3 publication(s) in Google Scholar
MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli[1][2].
Background
CCL8, also known as monocyte chemotactic protein 2 ( MCP2), is a small cell factor belonging to the CC chemokine family. First identified in human osteosarcoma cells, it is a protein encoded by the CCL8 gene located on human chromosome 17. CCL8 is mainly expressed in small intestine and peripheral blood cells. CCL8 can bind to several different chemokine cell surface receptors, such as CCR1, CCR2B, CCR3 and CCR5. CCL8 can act as a chemoattractant, attracting chemokines such as monocytes, lymphocytes, basophils and eosinophils to mediate inflammatory host responses. On the one hand, CCL8 contributes to the spread of breast cancer and promotes the migration and invasion of esophageal squamous cell carcinoma. On the other hand, it has also been reported that CCL8 inhibits cervical cancer tumor growth and exhibits anti-tumor metastatic effects in melanoma. cCL8 significantly activates ERK1/2 phosphorylation in glioblastoma cells and significantly reduces the invasiveness of glioma cells by neutralizing antibody blockade of tama-secreted CCL8. At the same time, CCL8 can act as a potent HIV1 inhibitor with high affinity for the receptor CCR5, which is one of the major co-receptors for HIV1[1][2].
In Vitro
MCP2/CCL8 (20-180 µg/mL) can stimulate the proliferation of splenic lymphocytes of immunosuppressed mice in a dose-dependent manner, with the highest proliferation index at a concentration of 180 μg/mL, which is 3.82 times higher than that of the normal group[3].
In Vivo
MCP2/CCL8(i.p., 1 μg in 200 μL of PBS, once daily, 14 days) decreases in the number and size of tumor colonies in the liver compared with vector-treated mice, suggesting an anti-tumor metastatic effect in C57BL/6 mice with B16 F10 cells[4].
Verified Bioactivity
1.Full biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 0.05265 μg/mL, corresponding to a specific activity is 1.899×104 U/mg.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR2. The ED50 for this effect is 0.05736-0.060 μg/mL, corresponding to a specific activity is 1.67-1.74×104 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Nat Methods
Genetically encoded biosensor for monitoring spatiotemporal dynamics of CCR2 ligands in culture and in vivo. [Abstract]2025 Aug;22(8):1731-1741. PMID: 40665002 -
J Clin Invest
Tumor initiating cells escape tumor immunity via CCL8 from tumor-associated macrophages in mice. [Abstract]2025 Jan 7;135(5):e180893. PMID: 39774471 -
Cancer Lett
Targeting C/EBPβ/SCD1/C16:1 loop-driven macrophage M2 polarization by Bruceine D improves anti-PD-1 immunotherapy in colorectal cancer. [Abstract]2026 Sep 28:656:218655. PMID: 42250753
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Z121 (G24-P97)
-
Molecular Construction
-
N-term
-
CCL8 (G24-P97)
Accession # Q9Z121 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL8; Chemokine (C-C Motif) Ligand 8; Prev. SCYA8; Small-Inducible Cytokine A8; MCP-2; C-C Motif Chemokine 8; HC14; SCYA10; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 8 (Monocyte Chemotactic Protein 2); MCP2; Monocyte Chemoattractant Protein 2
-
AA Sequence
GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
-
Predicted Molecular Mass
8.5 kDa
-
Molecular Weight
Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100(4):619-629. [Content Brief]
[2]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412. [Content Brief]
[3]. Yuan-Yuan Deng, et al. Immunomodulatory activity and partial characterisation of polysaccharides from Momordica charantia. Molecules. 2014 Aug 29;19(9):13432-47. [Content Brief]
[4]. Kiyokazu Hiwatashi, et al. Suppression of SOCS3 in macrophages prevents cancer metastasis by modifying macrophage phase and MCP2/CCL8 induction. Cancer Lett. 2011 Sep 28;308(2):172-80. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)