PD-L1 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Canine (HEK293, His) is the recombinant canine-derived PD-L1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Canine (HEK293, His) is the recombinant canine-derived PD-L1 protein, expressed by HEK293 , with C-His labeled tag.
Background
PD-L1 Protein assumes a critical role in both the induction and maintenance of immune tolerance to self, acting as a ligand for the inhibitory receptor PDCD1/PD-1 and thereby modulating the activation threshold of T-cells, ultimately limiting their effector response. Additionally, PD-L1 may function as a costimulatory molecule for T-cell subsets that predominantly produce interleukin-10 (IL10) through an as yet unidentified activating receptor. Beyond its role as an immune checkpoint, PD-L1 also acts as a transcription coactivator, translocating into the nucleus in response to hypoxia and interacting with phosphorylated STAT3 to promote the transcription of GSDMC, leading to pyroptosis. Exploited by tumors to attenuate anti-tumor immunity and escape immune system destruction, the PDCD1-mediated inhibitory pathway facilitated by PD-L1 interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blocking the PDCD1-mediated pathway has shown promise in reversing exhausted T-cell phenotypes and normalizing anti-tumor responses, providing a rationale for cancer immunotherapy.
Verified Bioactivity
Canine PD-L1 immobilized on CM5 Chip can bind Canine PD-1 (HY-P73342) with an affinity constant of 10.23 nM as determined in a SPR assay.
MCE Validation Data
-
Bioactivity - SPR
Bioactivity - SPR
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His
-
Accession
E2RKZ5/NP_001278901.1 (F19-R236)
-
Molecular Construction
-
N-term
-
PD-L1 (F19-R236)
Accession # E2RKZ5/NP_001278901.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1
-
AA Sequence
FTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASER
-
Predicted Molecular Mass
26.2 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)