PLA2G2E Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

Background

PLA2G2E, a secretory calcium-dependent phospholipase A2, predominantly targets extracellular phospholipids and exhibits phospholipase A2 activity by hydrolyzing the ester bond of the fatty acyl group at the sn-2 position of phospholipids. This enzymatic action results in the release of various unsaturated fatty acids, including oleoate, linoleoate, arachidonate, docosahexaenoate, and lysophosphatidylethanolamines, with a preference for lysophosphatidylethanolamines over lysophosphatidylcholines. In response to a high-fat diet, PLA2G2E hydrolyzes minor lipoprotein phospholipids, such as phosphatidylserines, phosphatidylinositols, and phosphatidylglycerols, thereby influencing lipoprotein composition and fat storage in adipose tissue and liver. Operating in an autocrine and paracrine manner, PLA2G2E contributes to lipid remodeling in cellular membranes and the generation of lipid mediators vital for pathogen clearance. Additionally, it acts as a hair follicle phospholipase A2, selectively releasing lysophosphatidylethanolamines and various unsaturated fatty acids in the skin to regulate hair follicle homeostasis. Furthermore, PLA2G2E may play a role in regulating the inflammatory response by releasing arachidonate, a precursor of prostaglandins and leukotrienes. Upon allergen exposure, it potentially participates in the allergic inflammatory response by enhancing leukotriene C4 synthesis and degranulation in mast cells.

Verified Bioactivity

Measured by its ability to hydrolyze 80 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine that incubate at room temperature in kinetic mode for 3 minutes. The specific activity is >3.5 pmol/min/μg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PLA2G2E (N20-C142)
      Accession # Q9QUL3
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLA2G2E; GIIE SPLA2; Phospholipase A2 Group IIE; SPLA2-IIE; Phosphatidylcholine 2-Acylhydrolase 2E; Phospholipase A2, Group IIE; Group IIE Secretory Phospholipase A2

  • AA Sequence

    NLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC

  • Molecular Weight

    Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00