RANK/TNFRSF11A Protein, Human (HEK293, His)

RANK (TNFRSF11A) is a receptor activator of nuclear factor κB (NF-κB), which is involved in bone metabolism and immune system function. RANK is mainly expressed by osteoblasts/stromal cells, and is associated with the formation of giant cell tumor of bone (GCTBs) . RANK combined with RANKL ligand activated the RANKL/RANK/ OPG system to regulate bone resorption . RANKL/RANK is also a regulator of dendritic cell (DC)-T cell interaction, which is associated with mammary epithelial formation and central nervous system thermoregulation in lactating female . RANK/TNFRSF11A Protein, Human (HEK293, His) has 183 amino acids (I30-P212), produced by HEK293 cells with C-terminal 6*His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

RANK (TNFRSF11A) is a receptor activator of nuclear factor κB (NF-κB), which is involved in bone metabolism and immune system function. RANK is mainly expressed by osteoblasts/stromal cells, and is associated with the formation of giant cell tumor of bone (GCTBs) [1]. RANK combined with RANKL ligand activated the RANKL/RANK/ OPG system to regulate bone resorption [2]. RANKL/RANK is also a regulator of dendritic cell (DC)-T cell interaction, which is associated with mammary epithelial formation and central nervous system thermoregulation in lactating female [3][4]. RANK/TNFRSF11A Protein, Human (HEK293, His) has 183 amino acids (I30-P212), produced by HEK293 cells with C-terminal 6*His-tag.

Background

RANK (TNFRSF11A), is the receptor activator of nuclear factor-κB (NF-κB), has originally been described to play key roles in bone metabolism and the immune system. RANK belongs to tumor necrosis factor receptor superfamily, acts function during osteoclasts differentiation and activation. RANK expressed by osteoblast/stromal cells, ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland. However, osteoblast typically are present in large numbers in giant cell tumors of bone (GCTBs), suggesting the affect of expressing factors in tumors that stimulate osteoclasts precursor recruitment and differentiation[1]. RANK binds RANKL, the receptor activator of NF-κB ligand, to trigger RANKL/RANK/osteoprotegerin (OPG) system to regulate bone resorption. Specifically, the RANKL/RANK signaling pathway promotes the formation of multicellular osteoclast precursors and ensures the activation and survival of multicellular osteoclasts under normal bone remodeling and various pathological conditions. OPG protects bone from excessive bone resorption by competitively binding to RANKL and hindering RANK binding to RANKL[2]. In addition to RANK's contribution to bone metabolism, the RANKL/RANK system is also involved in dendritic cell (DC)-T cell interactions. In rheumatoid synovium and lymph node pairs, the expression levels of RANK and RANKL can be used as markers to determine the interaction between dendritic cells and T cells[3]. Moreover, RANKL-RANK system is critical in the formation of mammary epithelia in lactating females and the thermoregulation of the central nervous system. As them under the tight control of the female sex hormones estradiol and progesterone, RANKL-RANK causes osteoporosis in postmenopausal women when circulating female sex hormones decrease. Furthermore, RANKL-RANK signaling also plays a critical role in other bone pathologies, bone metastasis or hormone-driven breast cancer[4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RANK (I30-P212)
      Accession # Q9Y6Q6
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFRSF11A; Familial Expansile Osteolysis; Prev. LOH18CR1; Paget Disease Of Bone 2; Prev. PDB2; TRANCE Receptor; RANK; Tumor Necrosis Factor Receptor Superfamily, Member 11a, Activator Of NFKB; ODFR; Receptor Activator Of Nuclear Factor Kappa B; Osteoclast

  • AA Sequence

    IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

  • Predicted Molecular Mass

    21.1 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00