RANTES/CCL5 Protein, Human (HEK293, Fc)
RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5, Human (HEK293, Fc) is the recombinant human-derived RANTES/CCL5 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5, Human (HEK293, Fc) is the recombinant human-derived RANTES/CCL5 protein, expressed by HEK293, with C-mFc labeled tag.
Background
RANTES/CCL5 Protein is a chemoattractant that plays a role in attracting blood monocytes, memory T-helper cells, and eosinophils. It also causes the release of histamine from basophils and activates eosinophils. RANTES can activate several chemokine receptors including CCR1, CCR3, CCR4, and CCR5. It is known to be one of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein has shown to inhibit different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) in a dose-dependent manner. There are different processed forms of RANTES, such as RANTES(3-68), which acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1 infection compared to the other processed forms RANTES(4-68) and RANTES(1-68). RANTES may also act as an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization. It is suggested that RANTES, along with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt, and MAP kinases. Additionally, by activating GPR75, RANTES may also contribute to insulin secretion by islet cells. RANTES can form homo and heterooligomers with other chemokines and has an interaction with the brown dog tick evasin-4.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P13501 (S24-S91)
-
Gene ID6352
-
Molecular Construction
-
N-term
-
CCL5 (S24-S91)
Accession # P13501 -
hFc
-
C-term
-
-
Protein Length
Full Length of C-C motif chemokine 5 Chain
-
Synonyms
CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon A
-
AA Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
-
Predicted Molecular Mass
34.4 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)