SCF Protein, Human (HEK293)
Based on 1 Customer Validation
SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (HEK293) is the recombinant human-derived SCF protein, expressed by HEK293, with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (HEK293) is the recombinant human-derived SCF protein, expressed by HEK293, with tag free.
The GMP stem cell factor (SCF) protein serves as a ligand for the receptor-type protein-tyrosine kinase KIT, playing a pivotal role in the regulation of diverse cellular processes. Its functions span the control of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding with KIT, GMP SCF activates multiple signaling pathways, including the phosphorylation of PIK3R1 and subsequent activation of the kinase AKT1. The interaction also triggers signaling cascades involving GRB2, RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, GMP SCF and KIT promote the activation of STAT family members (STAT1, STAT3, and STAT5), as well as PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Acting synergistically with other cytokines, likely interleukins, GMP SCF forms a homodimer non-covalently linked and a heterotetramer with KIT, facilitating KIT dimerization and subsequent activation through autophosphorylation.
1. Measured by its binding ability in a functional ELISA. Immobilized Human SCF, at 2 μg/mL (100 μL/well) can bind Biotinylated Human CD117, His, Avitag with a linear range of 0.02-0.3 μg/mL.
2. Human SCF, stimulates proliferation of Mo7e cells. The specific activity of Human SCF Protein, premium grade is > 5.0×105 IU/mg, which is calibrated against human SCF WHO International Standard.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P21583-1 (E26-A189)
-
Gene ID4254
-
Molecular Construction
-
N-term
-
SCF (E26-A189)
Accession # P21583-1 -
C-term
-
-
Protein Length
Full Length of Soluble KIT ligand
-
Synonyms
KITLG; SLF; Prev. MGF; Familial Progressive Hyperpigmentation 2; SCF; Steel Factor; Mast Cell Growth Factor; C-Kit Ligand; Stem Cell Factor; Kit Ligand; DFNA69; SHEP7; Kitl; DCUA; KL-1; FPHH; FPH2; WS2F; KIT Ligand; SF
-
AA Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 11% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
