1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E3 Ligases
  5. X-Linked Inhibitor Of Apoptosis (XIAP)
  6. XIAP Protein, Human (His)

XIAP protein is a multifunctional regulator that controls apoptosis, inflammation, immunity, copper homeostasis, and various signaling pathways. As a caspase inhibitor, it blocks CASP3 and CASP7 substrate access, keeping CASP9 inactive. XIAP Protein, Human (His) is the recombinant human-derived XIAP protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

XIAP protein is a multifunctional regulator that controls apoptosis, inflammation, immunity, copper homeostasis, and various signaling pathways. As a caspase inhibitor, it blocks CASP3 and CASP7 substrate access, keeping CASP9 inactive. XIAP Protein, Human (His) is the recombinant human-derived XIAP protein, expressed by E. coli , with N-His labeled tag.

Background

The XIAP protein serves as a multifunctional regulator with diverse roles spanning apoptosis, inflammatory signaling, immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, invasion, and metastasis. As a direct caspase inhibitor, XIAP impedes substrate entry into the active site pockets of CASP3 and CASP7, while also maintaining CASP9 in a monomeric, inactive state. Functioning as an E3 ubiquitin-protein ligase, XIAP orchestrates ubiquitination of several target proteins, including RIPK1, RIPK2, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS, PTEN, and BIRC5/survivin, thereby regulating NF-kappa-B signaling and other crucial pathways. In the realm of innate immunity, XIAP mediates 'Lys-63'-linked polyubiquitination of RIPK2 downstream of NOD1 and NOD2, activating NF-kappa-B and MAP kinases signaling. Additionally, XIAP influences the BMP signaling pathway, SMAD and MAP3K7/TAK1 dependent pathways, and the Wnt signaling cascade. It plays a role in copper homeostasis by ubiquitinating COMMD1 and also functions as an E3 ubiquitin-protein ligase in the NEDD8 conjugation pathway. Moreover, XIAP protects cells from spontaneous ripoptosome formation, suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8, and positively regulates Wnt signaling by ubiquitinating TLE proteins. These diverse functions underscore the intricate and pivotal role of XIAP in governing cellular processes across multiple signaling pathways.

Species

Human

Source

E. coli

Tag

N-His

Accession

P98170 (N252-T356)

Gene ID

331  [NCBI]

Molecular Construction
N-term
His
XIAP (N252-T356)
Accession # P98170
C-term
Protein Length

Partial

Synonyms
E3 ubiquitin-protein ligase XIAP; ILP; IAP-3; XIAP; API3; BIRC4
AA Sequence

NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT

Predicted Molecular Mass
14.3 kDa
Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

XIAP Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
XIAP Protein, Human (His)
Cat. No.:
HY-P73537
Quantity:
MCE Japan Authorized Agent: