XIAP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

XIAP protein is a multifunctional regulator that controls apoptosis, inflammation, immunity, copper homeostasis, and various signaling pathways. As a caspase inhibitor, it blocks CASP3 and CASP7 substrate access, keeping CASP9 inactive. XIAP Protein, Human (His) is the recombinant human-derived XIAP protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

XIAP protein is a multifunctional regulator that controls apoptosis, inflammation, immunity, copper homeostasis, and various signaling pathways. As a caspase inhibitor, it blocks CASP3 and CASP7 substrate access, keeping CASP9 inactive. XIAP Protein, Human (His) is the recombinant human-derived XIAP protein, expressed by E. coli , with N-His labeled tag.

Background

The XIAP protein serves as a multifunctional regulator with diverse roles spanning apoptosis, inflammatory signaling, immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, invasion, and metastasis. As a direct caspase inhibitor, XIAP impedes substrate entry into the active site pockets of CASP3 and CASP7, while also maintaining CASP9 in a monomeric, inactive state. Functioning as an E3 ubiquitin-protein ligase, XIAP orchestrates ubiquitination of several target proteins, including RIPK1, RIPK2, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS, PTEN, and BIRC5/survivin, thereby regulating NF-kappa-B signaling and other crucial pathways. In the realm of innate immunity, XIAP mediates 'Lys-63'-linked polyubiquitination of RIPK2 downstream of NOD1 and NOD2, activating NF-kappa-B and MAP kinases signaling. Additionally, XIAP influences the BMP signaling pathway, SMAD and MAP3K7/TAK1 dependent pathways, and the Wnt signaling cascade. It plays a role in copper homeostasis by ubiquitinating COMMD1 and also functions as an E3 ubiquitin-protein ligase in the NEDD8 conjugation pathway. Moreover, XIAP protects cells from spontaneous ripoptosome formation, suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8, and positively regulates Wnt signaling by ubiquitinating TLE proteins. These diverse functions underscore the intricate and pivotal role of XIAP in governing cellular processes across multiple signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • XIAP (N252-T356)
      Accession # P98170
    • C-term
  • Protein Length

    Partial

  • Synonyms

    XIAP; X‑Linked Inhibitor Of Apoptosis; BIRC4; API3; E3 Ubiquitin‑Protein Ligase XIAP; X‑Linked Inhibitor Of Apoptosis, E3 Ubiquitin Protein Ligase; Baculoviral IAP Repeat‑Containing Protein 4; RING‑Type E3 Ubiquitin Transferase XIAP; Inhibitor Of Apoptosi

  • AA Sequence

    NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT

  • Predicted Molecular Mass

    14.3 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00