country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5947

Copy Link Print Information

Tat-HA-NR2B9c

Tat-HA-NR2B9 contains a fragment of the cellmembrane transduction domain of HIV-1 Tat, a influenza virus hemagglutinin (HA) epitope-tag, and the C-terminal 9 amino acids of NR2B (NR2B9c). Tat-HA-NR2B9 reduces infarct size and improves neurological functions in ischemia-induced cerebral injury in the rats

For research use only. We do not sell to patients.

Formula: C₁₆₉H₂₆₉N₅₅O₅₀
Molecular Weight:3871.28

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Tat-HA-NR2B9c Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All HIV Isoforms :

Chemical Information

Molecular Weight 3871.28
Formula C₁₆₉H₂₆₉N₅₅O₅₀
Sequence

Pro-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Gly-Lys-Leu-Ser-Ser-Ile-Glu-Ser-Asp-Val
Sequence Shortening

PGYGRKKRRQRRRGYPYDVPDYAGKLSSIESDV
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Zhou HH, et al. Cloning, expression, and purification of a recombinant Tat-HA-NR2B9c peptide. Protein Expr Purif. 2012 Oct;85(2):239-45. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock