1. GPCR/G Protein
  2. GLP Receptor
  3. Zovaglutide

Zovaglutide (ZT002) is a long-acting, selective GLP-1 receptor agonist. Zovaglutide enhances albumin binding capacity via dual fatty acid chain modification. Zovaglutide exerts metabolic effects through central and peripheral GLP-1 pathways, thereby promoting satiety, reducing caloric intake and enhancing glucose-dependent insulin secretion, with no activity against GIP or glucagon receptors. Zovaglutide can be used in research on type 2 diabetes or obesity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Zovaglutide

Zovaglutide Chemical Structure

CAS No. : 3013543-64-8

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Zovaglutide (ZT002) is a long-acting, selective GLP-1 receptor agonist. Zovaglutide enhances albumin binding capacity via dual fatty acid chain modification. Zovaglutide exerts metabolic effects through central and peripheral GLP-1 pathways, thereby promoting satiety, reducing caloric intake and enhancing glucose-dependent insulin secretion, with no activity against GIP or glucagon receptors. Zovaglutide can be used in research on type 2 diabetes or obesity[1].

IC50 & Target[1]

GLP-1

 

In Vitro

Zovaglutide enhances albumin-binding capacity via dual fatty acid chain modification, thereby prolonging systemic exposure time[1].
Zovaglutide exerts metabolic effects via central and peripheral GLP-1 pathways, thereby promoting satiety, reducing caloric intake, and enhancing glucose-dependent insulin secretion[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

8393.21

Formula

C374H584N96O123

CAS No.
Sequence

His-{Aib}Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Gly-Gly-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Gln-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-Pro

Sequence Shortening

H-{Aib}-EGTFTSDVSSYLEEQAA-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-EFIAWLVRGGGGAQPGAQPGAQPGAQPGAQPGAQPGAQPGAQPGAQPGQ-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-P

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Zovaglutide
Cat. No.:
HY-P10965
Quantity:
MCE Japan Authorized Agent: