Neurological Disease

11-Nor-9(S)-carboxy-hexahydrocannabinol (11-Nor-9α-carboxy-HHC) is structurally similar to known phytocannabinoids.

Cariprazine (Standard) is the analytical standard of Cariprazine. This product is intended for research and analytical applications. Cariprazine is a novel antipsychotic agent candidate that exhibits high affinity for the D₃ (K_i=0.085 nM) and D₂ (K_i=0.49 nM) receptors, and moderate affinity for the 5-HT_1A receptor (K_i=2.6 nM).

Tenofovir maleate (GS 1278 maleate; PMPA maleate) is a nucleotide reverse transcriptase inhibitor to treat HIV and chronic Hepatitis B (HBV).

TAE-1 is a potent inhibitor of AChE and BuChE. TAE-1 also inhibits Aβ fibril formation and aggregation. TAE-1 can be used for the researches of Alzheimer's disease.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

4,27-Dimethyl withaferin A is a synthetic analog of withanolide natural products. 4,27-Dimethyl withaferin A has the potential for the research of neurodegenerative diseases (extracted from patent WO2015077780A1).

epi-Aszonalenin A is a benzodiazepine fungal metabolite originally isolated from Aspergillus novofumigatus. epi-Aszonalenin A can be used as a psychoactive agent.

AGI-12026 is brain-penetrant dual inhibitor of mutant IDH1 and 2. AGI-12026 shows partial inhibition of the IDH1-R132H homodimer as allosteric modulators. AGI-12026 has the potential for research of glioma.

BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC₅₀ of 0.05 μM.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

UBP296 is a potent and selective antagonist of GLU_K5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.

Kassinin is a peptide derived from the Kassina frog. It belongs to tachykinin family of neuropeptides. It is secreted as a defense response, and is involved in neuropeptide signalling.

β-Amino Acid Imagabalin Hydrochloride (PD-0332334) is a ligand for the α2δ subunit of the voltage-dependent calcium channel.

Endomorphin 2, a high affinity, highly selective agonist of the μ-opioid receptor, displays reasonable affinities for kappa₃ binding sites, with K_i value between 20 and 30 nM.

5-HT3 antagonist 3 (Compound 15b) is a high-affinity 5-HT3 receptor antagonist. 5-HT3 antagonist 3 binds to 5-HT3 receptors in rat brain cortical membranes with K_i of 0.25 nM.

MEN11467 is a selective and orally- effective peptidomimetic tachykinin NK₁ receptor antagonist.

ST4206 is a potent and orally active adenosine A2A receptor antagonist, with K_is of 12 nM and 197 nM for adenosine A2A receptor and adenosine A1 receptor, respectively. ST4206 has the potential for Parkinson׳s disease research.

Carburazepam is a agent which derives from benzodiazepine. Benzodiazepines (BZD, BZs) are a class of psychoactive agents whose core chemical structure is the fusion of a benzene ring and a diazepine ring.

Physalaemin, a non-mammalian tachykinin, binds selectively to neurokinin-1 (NK1) receptor with high affinity.

Phe-Met-Arg-Phe, amide dose dependently (ED₅₀=23 nM) activates a K⁺ current in the peptidergic caudodorsal neurons.