Aah II

Cat. No.: HY-P5144: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Aah II is a sodium channel modulator. Aah II is a toxin that can be isolated from the venom of scorpion Androctonus australis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Aah II Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Aah II is a sodium channel modulator. Aah II is a toxin that can be isolated from the venom of scorpion Androctonus australis^[1]^[2].
Molecular Weight	7243.04
Formula	C₃₁₃H₄₅₇N₈₉O₉₅S₈
Sequence	Val-Lys-Asp-Gly-Tyr-Ile-Val-Asp-Asp-Val-Asn-Cys-Thr-Tyr-Phe-Cys-Gly-Arg-Asn-Ala-Tyr-Cys-Asn-Glu-Glu-Cys-Thr-Lys-Leu-Lys-Gly-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ala-Ser-Pro-Tyr-Gly-Asn-Ala-Cys-Tyr-Cys-Tyr-Lys-Leu-Pro-Asp-His-Val-Arg-Thr-Lys-Gly-Pro-Gly-Arg-Cys-His-NH2 (Disulfide bridge:Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48)
Sequence Shortening	VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH-NH2 (Disulfide bridge:Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Duval A, et al. Changes in Na channel properties of frog and rat skeletal muscles induced by the AaH II toxin from the scorpion Androctonus australis. Pflugers Arch. 1989 Dec;415(3):361-71. [Content Brief] [2]. Legros C, et al. Expression of the standard scorpion alpha-toxin AaH II and AaH II mutants leading to the identification of some key bioactive elements. Biochim Biophys Acta. 2005 May 25;1723(1-3):91-9. [Content Brief]

Aah II Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Aah IISodium ChannelNa channelsNa+ channelsScorpiontoxinNa+ channelInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Aah II

Aah II Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review