Kaliotoxin
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 145199-73-1
- Formel: C171H283N55O49S8
- Molecular Weight:4149.94
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Protokoll
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Beschreibung
IC50 & Target
Kd: 20 nM (KCa channel)[1]
In Vitro
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague–Dawley rats (280–300 g)[2]
-
Dosage:10 ng
-
Administration:Intracerebroventricular injection
-
Result:Improved learning but not information consolidation.
Increased the long-term retrieval of an odour-reward association.
Chemical Information
-
CAS. Nr. 145199-73-1
-
Molecular Weight 4149.94
-
Formel C171H283N55O49S8
-
Sequence
Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Sequence Shortening
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. M Crest, et al. Kaliotoxin, a novel peptidyl inhibitor of neuronal BK-type Ca(2+)-activated K+ channels characterized from Androctonus mauretanicus mauretanicus venom. J Biol Chem. 1992 Jan 25;267(3):1640-7. [Content Brief]
[2]. S Kourrich, et al. Kaliotoxin, a Kv1.1 and Kv1.3 channel blocker, improves associative learning in rats. Behav Brain Res. 2001 Apr 8;120(1):35-46. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Kaliotoxin Related Classifications
HY-P1281 Related Classifications
Powered by Bioz