country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Art. -Nr.: HY-P5739

Copy Link Print Information

Mram 8

Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

CAS. Nr.: 1803183-45-0
Formel: C₁₃₂H₂₀₈N₃₆O₃₉S₆
Molecular Weight:3115.67

Speicherung:

Please store the product under the recommended conditions in the Certificate of Analysis.

Mram 8 Chemical Structure

CAS. Nr.: 1803183-45-0

Größe

Preis

Verfügbarkeit

Menge

Amount: USD 0.00

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biologische Aktivität

Beschreibung

Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family^[1].

Chemical Information

CAS. Nr. 1803183-45-0
Molecular Weight 3115.67
Formel C₁₃₂H₂₀₈N₃₆O₃₉S₆
Sequence

Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Sequence Shortening

Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Please store the product under the recommended conditions in the Certificate of Analysis.

Reinheit & Dokumentation

Select Batch:

Reinheit: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

Verweise

[1]. He W, et al. Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides. 2011 Aug;32(8):1719-23. [Content Brief]

Calculators

Molaritätsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Konzentration Konzentration

Volumen Volumen

Molecular Weight Molecular Weight

Verdünnungsrechner

Konzentration _{(Stammlösung)} × Volumen _{(Stammlösung)} = Konzentration _{(Ziellösung)} × Volumen _{(Ziellösung)}

Konzentration _{(Stammlösung)} Konzentration _{(Stammlösung)}

Volumen _{(Stammlösung)} Volumen _{(Stammlösung)}

Konzentration _{(Ziellösung)} Konzentration _{(Ziellösung)}

Volumen _{(Ziellösung)} Volumen _{(Ziellösung)}

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Angebot einholen Auf Lager