Cecropin D
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 83652-32-8
- Formel: C180H293N55O51
- Molecular Weight:4043.59
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Chemical Information
-
CAS. Nr. 83652-32-8
-
Molecular Weight 4043.59
-
Formel C180H293N55O51
-
Sequence
Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala-Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2
-
Sequence Shortening
WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Asma Hussain Alkatheri, et al. Host-Bacterial Interactions: Outcomes of Antimicrobial Peptide Applications. Membranes (Basel). 2022 Jul 19;12(7):715. [Content Brief]
[2]. Jian Peng, et al. Antimicrobial functional divergence of the cecropin antibacterial peptide gene family in Musca domestica. Parasit Vectors. 2019 Nov 14;12(1):537. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Cecropin D Related Classifications
HY-P3365 Related Classifications
Powered by Bioz