country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5689

Copy Link Print Information

Maximin 42

Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₃₉H₂₂₃N₃₃O₃₄
Masse moléculaire:2900.46

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Maximin 42 Chemical Structure

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells^[1].

Chemical Information

Masse moléculaire 2900.46
Formule C₁₃₉H₂₂₃N₃₃O₃₄
Sequence

Ser-Ile-Gly-Ala-Lys-Ile-Leu-Gly-Gly-Val-Lys-Thr-Phe-Phe-Lys-Gly-Ala-Leu-Lys-Glu-Leu-Ala-Phe-Thr-Tyr-Leu-Gln-NH2
Sequence Shortening

SIGAKILGGVKTFFKGALKELAFTYLQ-NH2
Structure Classification
- Ketones, Aldehydes, Acids
Initial Source
- Animals
Bombina
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Liu R, et al. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads. J Proteome Res. 2011 Apr 1;10(4):1806-15. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis