Copy Link Print Information

EGF Protein, Human

107 Cited Publications
Avis client

Based on 107 publication(s) in Google Scholar

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
  • Species: Human
  • Source: E. coli
  • Stockage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • EGF Protein, Human Product Image
Size
Prix
Stock
Quantité
Amount: USD 0.00
Please select quantity
or
or

* Veuillez sélectionner la quantité avant d'ajouter des articles.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Trouvez votre distributeur local Your local distributor: Hycultec GmbHHycultec
  • Activité biologique
  • Technical Parameters
  • Product Properties
  • Documentation
  • Références
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Activité biologique

Description

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Background

EGF Protein emerges as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro environments, along with fostering the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesiotropic hormone, driving magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Notably, EGF Protein possesses the capability to induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Its molecular interactions include binding to EGFR, thereby promoting EGFR dimerization, and interacting with RHBDF2, suggesting involvement in diverse cellular processes. Furthermore, EGF Protein engages with RHBDF1, potentially influencing the retention of EGF in the endoplasmic reticulum and regulating its degradation through endoplasmic reticulum-associated degradation (ERAD).

In Vitro

EGF Protein, Human (0-500 ng/mL, 72 h) promotes the proliferation of NIH 3T3 cells[3].

In Vivo

EGF Protein (Human) (10 μg/g, cream, a single dose for 7 days) reduces inflammatory infiltrate and results in wound re-epithelialization in rats with full thicknessskin wounds[1].
EGF Protein (Human) (50 μg/g, cream, every 24 h for 7 days) significantly stimulates re-epithelialization at high levels, preferably in combination with a protease inhibitor in pigs with thickness wounds on the back[1].
EGF Protein (Human) (30 μg/kg, s.c., daily for 3 weeks) attenuates the oesophageal damage normally caused by the sclerotherapy (surgical dilation of the oesophagus) procedure in Gottingen minipigs[1].

Verified Bioactivity

Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is <200 pg/mL.

Données de validation de MCE

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 53.08 pg/mL, corresponding to a specific activity is 1.88×107 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01133-1 (N971-R1023)

  • Gene ID
    1950  [NCBI]
  • Molecular Construction
    • N-term
    • EGF (N971-R1023)
      Accession # P01133
    • C-term
  • Protein Length

    Full Length of EGF

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

  • Predicted Molecular Mass

    6.2 kDa

  • Masse moléculaire

    Approximately 6-11 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Pureté

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM PB, 200 mM NaCl, pH 7.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
6.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Références

[1]. Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71. [Content Brief]

[2]. Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102(2):89-98. [Content Brief]

[3]. Pouranvari S, et al., Cloning, Expression, and Cost Effective Purification of Authentic Human Epidermal Growth Factor With High Activity. Iran Red Crescent Med J. 2016 Mar 20;18(3):e24966. [Content Brief]

Calculators

Calculateur de reconstitution

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculateur de dilution

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtenir un devis En stock

Other size
Obtenir un devis
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 53.08 pg/mL, corresponding to a specific activity is 1.88×107 units/mg.

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2025 Oct 16. [Abstract]

    Customer Validation
     Primary CRC organoids (CRC‐74 and CRC‐828) were cultured in DMEM/F12 supplemented with N2, B27, 10 mmol/L HEPES, 1.25 mmol/L N‐acetyl cysteine, 10 mmol/L SB202190‐monohydrochloride, 500 ng/mL R‐spondin‐1, 100 ng/mL Noggin, 100 ng/mL Wnt3a (HY‐P70453A, MedChemExpress), 50 ng/mL EGF (HY‐P7109, MedChemExpress), and 100 units/mL penicillin/streptomycin. The growth of patient‐derived CRC organoids was suppressed upon silencing of TRMT61A.

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Cancer. 2024 Jul 9;23(1):141. [Abstract]

    Customer Validation
     LIU-LSC-1 cells transfected with PFKP shRNA were stimulated with or without EGF (50 ng/mL) for 15 min. PFKP is involved in EGFR-mediated activation of ERK1/2.

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2024 Apr;44(4):469-490. [Abstract]

    Customer Validation
     Cells were seeded in ultra‐low attachment plates and cultured in serum‐free RPMI‐1640 supplemented with 2% B27 supplemen, 20 ng/mL EGF (MCE), and 10 ng/mL bFGF (MCE) in a humidified 5% CO2 at 37°C. Additionally, 25 µM ICG‐001 or 100 ng/mL Wnt3A (MCE) was added in the culture medium. After one‐week incubation, tumor sphere numbers were counted under a phase‐contrast microscope. The role of hnRNPA2B1 in maintenance of gastric cancer stemness was evaluated.

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Genet. 2024 Feb;56(2):294-305. [Abstract]

    Customer Validation
     Trophoblast organoids constructed from hTSCs-BL. Trophoblast markers: CDH1 and hCG. Briefly, hTSCs were cultured in hTSCs medium (DMEM/F12 supplemented with 0.1 mM 2-mercaptoethanol, 0.2% FBS, 0.5% Penicillin–Streptomycin, 0.3% BSA, 1% ITS-X supplement, 1.5 μg/ml L-ascorbicacid, 50 ng/mL Epidermal Growth Factor (EGF)(MedChemExpress), 2 μM CHIR99021 (MedChemExpress), 0.5 μM A83-01 (MedChemExpress), 1 μM SB431542 (MedChemExpress), 0.8 mM Valproic acid and 5 μM Y27632 (MedChemExpress).

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Drug Resist Updat. 2024 Nov:77:101158. [Abstract]

    Customer Validation
     PCa-derived organoids were established and cultured in Matrigel. The culture medium consisted of Advanced DMEM/F-12 supplemented with B27, N-acetylcysteine, EGF (5 ng/ml, MCE, HY-P7109), Noggin (100 ng/ml), R-spondin 1 (500 ng/ml), A83-01 (500 nM), FGF10 (10 ng/ml), FGF2 (5 ng/ml), Prostaglandin E2 (1 μM), Nicotinamide (10 mM), SB202190 (10 μM), DHT (1 nM), and Y-27632 (10 μM). The combination of an ACSS2 inhibitor and ENZA resulted in the death of over 90 % of organoids compared with organoids treated with ENZA.

  • 1/16

    EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jun 11;15(1):4969. [Abstract]

    Customer Validation
     EGF (100 ng/mL; 10 h) increases the interaction between MYG1 and HSP90 in 293 T cells instead of LoVo cells with KRAS mutation.

  • EGF Protein, Human Product Image
    1/16
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • Experimental Validation Results for EGF Protein, Human
  • EGF Protein, Human Product Image

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2025 Oct 16. [Abstract]

    Primary CRC organoids (CRC‐74 and CRC‐828) were cultured in DMEM/F12 supplemented with N2, B27, 10 mmol/L HEPES, 1.25 mmol/L N‐acetyl cysteine, 10 mmol/L SB202190‐monohydrochloride, 500 ng/mL R‐spondin‐1, 100 ng/mL Noggin, 100 ng/mL Wnt3a (HY‐P70453A, MedChemExpress), 50 ng/mL EGF (HY‐P7109, MedChemExpress), and 100 units/mL penicillin/streptomycin. The growth of patient‐derived CRC organoids was suppressed upon silencing of TRMT61A.

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Cancer. 2024 Jul 9;23(1):141. [Abstract]

    LIU-LSC-1 cells transfected with PFKP shRNA were stimulated with or without EGF (50 ng/mL) for 15 min. PFKP is involved in EGFR-mediated activation of ERK1/2.

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2024 Apr;44(4):469-490. [Abstract]

    Cells were seeded in ultra‐low attachment plates and cultured in serum‐free RPMI‐1640 supplemented with 2% B27 supplemen, 20 ng/mL EGF (MCE), and 10 ng/mL bFGF (MCE) in a humidified 5% CO2 at 37°C. Additionally, 25 µM ICG‐001 or 100 ng/mL Wnt3A (MCE) was added in the culture medium. After one‐week incubation, tumor sphere numbers were counted under a phase‐contrast microscope. The role of hnRNPA2B1 in maintenance of gastric cancer stemness was evaluated.

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Genet. 2024 Feb;56(2):294-305. [Abstract]

    Trophoblast organoids constructed from hTSCs-BL. Trophoblast markers: CDH1 and hCG. Briefly, hTSCs were cultured in hTSCs medium (DMEM/F12 supplemented with 0.1 mM 2-mercaptoethanol, 0.2% FBS, 0.5% Penicillin–Streptomycin, 0.3% BSA, 1% ITS-X supplement, 1.5 μg/ml L-ascorbicacid, 50 ng/mL Epidermal Growth Factor (EGF)(MedChemExpress), 2 μM CHIR99021 (MedChemExpress), 0.5 μM A83-01 (MedChemExpress), 1 μM SB431542 (MedChemExpress), 0.8 mM Valproic acid and 5 μM Y27632 (MedChemExpress).

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Drug Resist Updat. 2024 Nov:77:101158. [Abstract]

    PCa-derived organoids were established and cultured in Matrigel. The culture medium consisted of Advanced DMEM/F-12 supplemented with B27, N-acetylcysteine, EGF (5 ng/ml, MCE, HY-P7109), Noggin (100 ng/ml), R-spondin 1 (500 ng/ml), A83-01 (500 nM), FGF10 (10 ng/ml), FGF2 (5 ng/ml), Prostaglandin E2 (1 μM), Nicotinamide (10 mM), SB202190 (10 μM), DHT (1 nM), and Y-27632 (10 μM). The combination of an ACSS2 inhibitor and ENZA resulted in the death of over 90 % of organoids compared with organoids treated with ENZA.

  • EGF Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jun 11;15(1):4969. [Abstract]

    EGF (100 ng/mL; 10 h) increases the interaction between MYG1 and HSP90 in 293 T cells instead of LoVo cells with KRAS mutation.