RANTES/CCL5 Protein, Human

7 Cited Publications
Revisión del cliente

Based on 7 publication(s) in Google Scholar

RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Referencias
  • Help & FAQs

Actividad biológica

Descripciòn

RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli[1][2].

Background

CCL5, also known as RANTES (Regulated upon Activation, Normal T Cell Expressed and Secreted), is part of the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes a CCL5 protein with a molecular weight of 8 kDa[1].
RANTES/CCL5 Protein can be secreted by many cell types, such as platelets, endothelial cells, smooth muscle cells, macrophages, and activated T cells[1].
RANTES/CCL5 Protein can induce the expression of MMP-1 and MMP-13 in human rheumatoid arthritis synovial fibroblasts by utilizing heparan sulfate proteoglycans (HSPGs) and/or selectively activating PKCδ, JNK, and ERK proteins in the PKCδ-JNK/ERK pathway, ultimately leading to collagen degradation[3].
RANTES/CCL5 Protein promotes angiogenesis by binding to GPCR, CCR1, and CCR5, as well as to its proteoglycan receptors SDC-1, SDC-4, and CD-44, and it partially relies on VEGF secreted by endothelial cells[1].
RANTES/CCL5 Protein is induced by the relevant cytokine IL-13 in mice infected with RSV, leading to airway hyperreactivity (AHR) and worsening airway diseases[4].
RANTES/CCL5 Protein interacts with CCR5, increasing the phosphorylation of MEK and ERK in the MEK/ERK pathway, activating NF-κB, leading to the activation of αvβ3 integrin and promoting the migration of human osteosarcoma cells[5].
The oligomeric form of RANTES/CCL5 Protein is important for some of its functions. RANTES/CCL5 Protein can form larger aggregates in neutral pH environments, while it forms smaller aggregates when the pH is lowered[6].
RANTES/CCL5 Protein is associated with various pathological processes, including viral infections, atherosclerosis, inflammatory diseases, autoimmune diseases, and tumors[1].

In Vitro

RANTES/CCL5 Protein (1 or 10 nM, 25 days) induces angiogenesis in a rat intervertebral disc angiogenesis model[1].
RANTES/CCL5 Protein (100 ng/mL, 24 h) can activate the expression of MMP-1 and MMP-13 in human rheumatoid arthritis synovial fibroblasts, thereby inducing collagen degradation[3].
RANTES/CCL5 Protein (3 ng/mL, 24 h) can promote the expression of α v β 3 integrin and cell migration in human osteosarcoma cells[6].
Reduced mTOR activity in RANTES/CCL5 Protein expression-deficient Rantes KO stem/progenitor cells results in a younger haematopoietic stem cell phenotype[7].

In Vivo

RANTES/CCL5 Protein is induced to produce in primary respiratory syncytial virus infected mice, exacerbating airway diseases[4].
Lack of expression of RANTES/CCL5 Protein in Rantes gene knockout (KO) mice can lead to a decrease in myeloid biased HSCs and myeloid progenitor cells, as well as an increase in T cells and lymphoid biased HSCs[7].

Verified Bioactivity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10.0 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 2.640-4.751 ng/mL.
3. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 1.0-10.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 4.751 ng/mL, corresponding to a specific activity is 2.105×105 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL5 (S24-S91)
      Accession # P13501
    • C-term
  • Protein Length

    Full Length of C-C motif chemokine 5 Chain

  • Synonyms

    CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon Activation, Normally T-Expressed, And Presumably Secreted; T Cell-Specific Protein P228; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 5; Small-Inducible Cytokine A5; Eosinophil Chemotactic Cytokine; C-C Motif Chemokine; Chemokine (C-C Motif) Ligand 5; C-C Motif Chemokine Ligand 5; Beta-Chemokine RANTES

  • AA Sequence

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

  • Predicted Molecular Mass

    7.8 kDa

  • Peso molecular

    Approximately 9-12 kDa, based on SDS-PAGE under reducing conditions.

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 6% trehalose, 4% mannitol, 0.05% Tween 80, pH 4.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Referencias

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00