Copy Link Print Information

IFN-gamma Protein, Mouse

53 Cited Publications
Customer Review

Based on 53 publication(s) in Google Scholar

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • IFN-gamma Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag[1][2][3][4].

Background

IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells[1][2][3][4].

In Vitro

IFN-gamma Protein (Mouse; 10 ng/mL; 24 h) can upregulate the expression of MHC-I and PD-L1 in tumor cell line MC38, and the effect is better when used in combination with Nintedanib (HY-50904)[5].

In Vivo

IFN-gamma Protein (Mouse; 10 ng; intranasal administration; on days 1, 3, and 5 post-infection) after primary respiratory syncytial virus (RSV) infection in mice significantly alleviates airway hyperresponsiveness (AHR) and inflammation upon reinfection[6].
IFN-gamma Protein (Mouse; 50,000 U/animal; intravenous injection; 3 times/week; 4 weeks) exhibits antitumor activity and reduces the number of lung metastatic foci in a mouse melanoma tumor model[7].

Verified Bioactivity

1. Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is < 1 ng/mL.
2. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is ≤0.7283 ng/mL, corresponding to a specific activity is ≥1.37×106 Unit/mg.
3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is <135 ng/mL.
4. Measured by its binding abiity in a functional ELISA. Immobilized Mouse IFN gamma at 10 μg/ml (100 μL/well) can bind Mouse CD119 (HY-P72611). The ED50 for this effect is <100 ng/mL.

Results
  • Experimental Validation Results for IFN-gamma Protein, Mouse
    Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.
  • Experimental Validation Results for IFN-gamma Protein, Mouse
    When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is 74.54 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01580 (H23-C155)

  • Gene ID
    15978  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-gamma (H23-C155)
      Accession # P01580
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    rMuIFN-γ; IFNG; IFN-gamma; Interferon gamma

  • AA Sequence

    HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

  • Predicted Molecular Mass

    15.5 kDa

  • Molecular Weight

    Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IFN-gamma Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]

[2]. Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81. [Content Brief]

[3]. Chesler DA, et al. The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13(6):441-54. [Content Brief]

[4]. Goedhart M, et al. Interferon-Gamma Impairs Maintenance and Alters Hematopoietic Support of Bone Marrow Mesenchymal Stromal Cells. Stem Cells Dev. 2018 May 1;27(9):579-589. [Content Brief]

[5]. Tu J, et al. Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. Theranostics. 2022 Jan 1;12(2):747-766. [Content Brief]

[6]. Lee YM, et al. IFN-gamma production during initial infection determines the outcome of reinfection with respiratory syncytial virus. Am J Respir Crit Care Med. 2008 Jan 15;177(2):208-18. [Content Brief]

[7]. Talmadge JE, et al. Immunomodulatory and immunotherapeutic properties of recombinant gamma-interferon and recombinant tumor necrosis factor in mice. Cancer Res. 1987 May 15;47(10):2563-70. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.

  • When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is 74.54 ng/mL.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.

  • 1/16

    MedChemExpress Validation
     When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is 74.54 ng/mL.

  • 1/16

    IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Cell. 2025 Dec 8;43(12):2282-2297.e9. [Abstract]

    Customer Validation
     Naive CD8+ T cells were cultured in medium alone or cocultured with SVEC4-10 cells, IFNγ (500 ng/mL; 72 h) -treated SVEC4-10 cells, or BMDMs, respectively, ± OVA 257-264 at 2:1 ratio for 72 h. Percentages of IFNγ+, CD69+, GZMB+, and Perforin+ were detected by FACS.

  • 1/16

    IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Nov 11. [Abstract]

    Customer Validation
     Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 cells under different TSPAN13 expression levels, with or without IFNγ(30 ng/mL; 24 h) stimulation.

  • 1/16

    IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Surg. 2025 Jun 27. [Abstract]

    Customer Validation
     IFN-γ (20 ng/mL; 48 h). Relative expression levels of circCCDC719-13 in THP-1 macrophages under different polarization states: M0 (unpolarized), M1 (classically activated), and M2 (alternatively activated).

  • 1/16

    IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    Customer Validation
     PD-L1 expression after IFN-γ (10 ng/ml; 24 h ) treatment in MC38 cells.

  • 1/16

    IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 10 March 2022.

    Customer Validation
     Quantification of T cell proliferation with the supernatant from BMDM treated with LPS (50 ng/mL)/IFN-γ (20 ng/mL) for 48 h by flow cytometry.

  • IFN-gamma Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • Experimental Validation Results for IFN-gamma Protein, Mouse
  • IFN-gamma Protein, Mouse Product Image

  • IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Cell. 2025 Dec 8;43(12):2282-2297.e9. [Abstract]

    Naive CD8+ T cells were cultured in medium alone or cocultured with SVEC4-10 cells, IFNγ (500 ng/mL; 72 h) -treated SVEC4-10 cells, or BMDMs, respectively, ± OVA 257-264 at 2:1 ratio for 72 h. Percentages of IFNγ+, CD69+, GZMB+, and Perforin+ were detected by FACS.

  • IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Nov 11. [Abstract]

    Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 cells under different TSPAN13 expression levels, with or without IFNγ(30 ng/mL; 24 h) stimulation.

  • IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Surg. 2025 Jun 27. [Abstract]

    IFN-γ (20 ng/mL; 48 h). Relative expression levels of circCCDC719-13 in THP-1 macrophages under different polarization states: M0 (unpolarized), M1 (classically activated), and M2 (alternatively activated).

  • IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    PD-L1 expression after IFN-γ (10 ng/ml; 24 h ) treatment in MC38 cells.

  • IFN-gamma Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 10 March 2022.

    Quantification of T cell proliferation with the supernatant from BMDM treated with LPS (50 ng/mL)/IFN-γ (20 ng/mL) for 48 h by flow cytometry.