(D-His1)-Exenatide
(D-His1)-Exenatide is one od impurities of Exenatide.
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 1678417-09-8
- Fòrmula: C184H282N50O60S
- Peso molecular:4186.57
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
-
Help & FAQs
Actividad biológica
Chemical Information
-
No. CAS 1678417-09-8
-
Peso molecular 4186.57
-
Fòrmula C184H282N50O60S
-
Sequence
{d-His}-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
-
Sequence Shortening
{d-His}-GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
(D-His1)-Exenatide Related Classifications
HY-P4503 Related Classifications
Powered by Bioz