(D-His1)-Exenatide
(D-His1)-Exenatide is one od impurities of Exenatide.
For research use only. We do not sell to patients.
- CAS No.: 1678417-09-8
- Formula: C184H282N50O60S
- Molecular Weight:4186.57
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
-
Help & FAQs
Biological Activity
Chemical Information
-
CAS No. 1678417-09-8
-
Molecular Weight 4186.57
-
Formula C184H282N50O60S
-
Sequence
{d-His}-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
-
Sequence Shortening
{d-His}-GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
(D-His1)-Exenatide Related Classifications
HY-P4503 Related Classifications
Powered by Bioz